@Article{digerfeldt1992reconstructionofpastlakelevelsandtheirrelationtogrdwaterhydrologyintheparkersprairiesandplainwestcentralminnesota,
  doi = {10.1016/0031-0182(92)90115-l},
  url = {https://doi.org/10.1016/0031-0182(92)90115-l},
  year = {1992},
  month = {jul},
  publisher = {Elsevier {BV}},
  volume = {94},
  number = {1-4},
  pages = {99--118},
  author = {Gunnar Digerfeldt and James E Almendinger and Svante Bj{\"o}rck},
  title = {Reconstruction of past lake levels and their relation to groundwater hydrology in the Parkers Prairie sandplain, west-central Minnesota},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{bannert1970zurgeologiederdanakilsenkenrdlichesafargebietnethiopien,
  doi = {10.1007/bf01823804},
  url = {http://dx.doi.org/10.1007/BF01823804},
  year = {1970},
  month = {feb},
  publisher = {Springer Science and Business Media LLC},
  volume = {59},
  number = {2},
  pages = {409–443},
  author = {D. Bannert and J. Brinckmann and K. -Ch. K{\"a}ding and G. Knetsch and M. K{\"U}rsten and H. Mayrhofer},
  title = {Zur Geologie der Danakil-Senke: Nördliches Afar-Gebiet, NE-Äthiopien},
  journal = {Geologische Rundschau},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{bannert1970zurgeologiederdanakilsenke,
  doi = {10.1007/bf01823804},
  url = {https://doi.org/10.1007/bf01823804},
  year = {1970},
  month = {feb},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {59},
  number = {2},
  pages = {409--443},
  author = {D. Bannert and J. Brinckmann and K. -Ch. K{\"a}ding and G. Knetsch and M. K{\"U}rsten and H. Mayrhofer},
  title = {Zur Geologie der Danakil-Senke},
  journal = {Geologische Rundschau},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{commelin1980chronologieisotopiquesahariennedesderniers10000ansbulletindumuseedanthropologieprehistoriquedemonaco233788,
  year = {1980},
  author = {D Commelin and N. Petit-Maire and J. Casanova},
  title = {Chronologie isotopique saharienne des derniers10,000 ans. Bulletin du Musee d'Anthropologieprehistorique de Monaco 23 : 37-88.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{butzer1973palaeohydrologyoflatepleistocenelakealexandersfonteinkimberleysouthafricanature243328330,
  doi = {10.1038/243328a0},
  url = {https://doi.org/10.1038/243328a0},
  year = {1973},
  month = {jun},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {243},
  number = {5406},
  pages = {328--330},
  author = {KARL W. BUTZER and G. J. FOCK and ROBERT STUCKENRATH and A. ZILCH},
  title = {Palaeohydrology of Late Pleistocene Lake, Alexandersfontein, Kimberley, South Africa},
  journal = {Nature},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{melief1982thepalynologyofpeatandlakedepositsinthecordilleracentraternarypaleoecologyoftheparquenacionalnaturallosnecadoscordill,
  year = {1982},
  author = {A.B.M. Melief and M.A. {van de Wijngaard}},
  title = {The palynology of peat and lake deposits in theCordillera Central: Laguna verde de la SieteCabezas. In: "Late Quaternary paleoecology of the Parque Nacional Natural los Necados (Cordill},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{kropelin1987643kropelins1987palaeoclimaticevidencefromearlytomidplayasinthegilfkebirsouthwestegyptpalaeoecologyofafrica18189208,
  year = {1987},
  author = {S. Kropelin},
  title = {643 Kropelin, S., 1987. Palaeoclimatic evidence from early to mid-Holocene playas in the Gilf Kebir (South-west Egypt).Palaeoecology of Africa 18 : 189-208.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{eldridge1975universityofmiamiradiocarbondatesiii,
  doi = {10.1017/s0033822200002083},
  url = {https://doi.org/10.1017/s0033822200002083},
  year = {1975},
  publisher = {Cambridge University Press ({CUP})},
  volume = {17},
  number = {2},
  pages = {239--246},
  author = {K L Eldridge and J J Stipp and S J Cohen},
  title = {University of Miami Radiocarbon Dates III},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{dury1973paleohydrologicimplicationsofsomepluviallakesinnorthwesternnewsouthwalesaustralia,
  doi = {10.1130/0016-7606(1973)84<3663:piospl>2.0.co;2},
  url = {https://doi.org/10.1130/0016-7606(1973)84<3663:piospl>2.0.co;2},
  year = {1973},
  publisher = {Geological Society of America},
  volume = {84},
  number = {11},
  pages = {3663},
  author = {G. H. DURY},
  title = {Paleohydrologic Implications of Some Pluvial Lakes in Northwestern New South Wales, Australia},
  journal = {Geological Society of America Bulletin},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{dury1973paleohydrologicimplicationsofsomepluviallakesinnorthwestwalesaustraliabulletinofthegeologicalsocietyofamerica8436633676,
  doi = {10.1130/0016-7606(1973)84<3663:piospl>2.0.co;2},
  url = {https://doi.org/10.1130/0016-7606(1973)84<3663:piospl>2.0.co;2},
  year = {1973},
  publisher = {Geological Society of America},
  volume = {84},
  number = {11},
  pages = {3663},
  author = {G. H. DURY},
  title = {Paleohydrologic Implications of Some Pluvial Lakes in Northwestern New South Wales, Australia},
  journal = {Geological Society of America Bulletin},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{schmieder2011aregionalscaleclimatereconstructionofthelast4000yearsfromlakesinthenebraskasandhillsusa,
  doi = {10.1016/j.quascirev.2011.04.011},
  url = {https://doi.org/10.1016/j.quascirev.2011.04.011},
  year = {2011},
  month = {jun},
  publisher = {Elsevier {BV}},
  volume = {30},
  number = {13-14},
  pages = {1797--1812},
  author = {J. Schmieder and S.C. Fritz and J.B. Swinehart and A.L.C. Shinneman and A.P. Wolfe and G. Miller and N. Daniels and K.C. Jacobs and E.C. Grimm},
  title = {A regional-scale climate reconstruction of the last 4000 years from lakes in the Nebraska Sand Hills, USA},
  journal = {Quaternary Science Reviews},
}

@Article{schmieder2012holocenevariabilityinhydrologyvegetationfireandeolianactivityinthenebraskasandhillsusa,
  doi = {10.1177/0959683612463100},
  url = {https://doi.org/10.1177/0959683612463100},
  year = {2012},
  month = {dec},
  publisher = {{SAGE} Publications},
  volume = {23},
  number = {4},
  pages = {515--527},
  author = {Jens Schmieder and Sherilyn C Fritz and Eric C Grimm and Kimberly C Jacobs and Kendrick J Brown and James B Swinehart and Stephen C Porter},
  title = {Holocene variability in hydrology, vegetation, fire, and eolian activity in the Nebraska Sand Hills, USA},
  journal = {The Holocene},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{gonzalez1983pleistoceneandholocenelakelevelsintheactualsalinadelntfasttropicalerosioncoastalsubsidenceandsubmergenceunpaginated,
  year = {1983},
  author = {M.A. Gonzalez},
  title = {Pleistocene and Holocene lake levels in the actual Salina del Bebedero, Argentina. 14C dates.Relations with the latest Pleistocene glaciation. Abstract, Hamburg Symposium on "DesertEncroachment, Fast Tropical Erosion, CoastalSubsidence and Submergence." Unpaginated.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{roberts1980latequaternarygeomorphologyandpalaeoecologyofthekonyabasinturkeyphdthesisuniversitycollegelondon296pp,
  year = {1980},
  author = {N. Roberts},
  title = {Late Quaternary Geomorphology and Palaeoecologyof the Konya Basin, Turkey. Ph.D. thesis,University College, London, 296pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{delibrias1974gifnaturalradiocarbonmeasurementsviii,
  doi = {10.1017/s0033822200001417},
  url = {https://doi.org/10.1017/s0033822200001417},
  year = {1974},
  publisher = {Cambridge University Press ({CUP})},
  volume = {16},
  number = {1},
  pages = {15--94},
  author = {G Delibrias and M T Guillier and J Labeyrie},
  title = {Gif Natural Radiocarbon Measurements VIII},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{young1979aradiocarbondatefromlakebogoriakenyariftvalley,
  doi = {10.1038/278243a0},
  url = {https://doi.org/10.1038/278243a0},
  year = {1979},
  month = {mar},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {278},
  number = {5701},
  pages = {243--245},
  author = {J. A. T. Young and R. W. Renaut},
  title = {A radiocarbon date from Lake Bogoria, Kenya Rift Valley},
  journal = {Nature},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{bright1966pollenandseedstratigraphyofswanlakesoutheasternidahoitiptoregionalvegetationalhistoryandtolakebonnevillehistorytebiwa,
  year = {1966},
  pages = {9:01},
  author = {R.C. Bright},
  title = {Pollen and seed stratigraphy of Swan Lake,southeastern Idaho : its relationship to regional vegetational history and to Lake Bonnevillehistory. Tebiwa},
  journal = {Journal of the Idaho StateUniversity Museum},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{shanahan2006paleoclimaticvariationsinwestafricafromarecordoflatepleistoceneandholocenelakelevelstandsoflakebosumtwighana,
  doi = {10.1016/j.palaeo.2006.06.007},
  url = {https://doi.org/10.1016/j.palaeo.2006.06.007},
  year = {2006},
  month = {dec},
  publisher = {Elsevier {BV}},
  volume = {242},
  number = {3-4},
  pages = {287--302},
  author = {Timothy M. Shanahan and Jonathan T. Overpeck and C. Winston Wheeler and J. Warren Beck and Jeffrey S. Pigati and Michael R. Talbot and Christopher A. Scholz and John Peck and John W. King},
  title = {Paleoclimatic variations in West Africa from a record of late Pleistocene and Holocene lake level stands of Lake Bosumtwi, Ghana},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{gasse1987diatomsforreconstructingpalaeoenvironmentsandpaleohydroyintropicalsemiaridzonesexampleofsomelakesfromnigersince12000bp,
  doi = {10.1007/bf00026837},
  url = {http://dx.doi.org/10.1007/BF00026837},
  year = {1987},
  month = {nov},
  publisher = {Springer Science and Business Media LLC},
  volume = {154},
  number = {1},
  pages = {127–163},
  author = {F. Gasse},
  title = {Diatoms for reconstructing palaeoenvironments and paleohydrology in tropical semi-arid zones: Example of some lakes from Niger since 12 000 BP},
  journal = {Hydrobiologia},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{gasse1987diatomsforreconstructingpalaeoenvironmentsandpaleohydrologyintropicalsemiaridzones,
  doi = {10.1007/bf00026837},
  url = {https://doi.org/10.1007/bf00026837},
  year = {1987},
  month = {nov},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {154},
  number = {1},
  pages = {127--163},
  author = {F. Gasse},
  title = {Diatoms for reconstructing palaeoenvironments and paleohydrology in tropical semi-arid zones},
  journal = {Hydrobiologia},
}

@Article{gasse1987diatomsforreconstructingpalaeoenvironmentsandpalaeohydresexampleofsomelakesfromnigersince12000bphydrobiologia154127163,
  doi = {10.1007/bf00026837},
  url = {https://doi.org/10.1007/bf00026837},
  year = {1987},
  month = {nov},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {154},
  number = {1},
  pages = {127--163},
  author = {F. Gasse},
  title = {Diatoms for reconstructing palaeoenvironments and paleohydrology in tropical semi-arid zones},
  journal = {Hydrobiologia},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{dodson1986holocenevegetationandenvironmentsneargoulburnnewsouthwales,
  doi = {10.1071/bt9860231},
  url = {https://doi.org/10.1071/bt9860231},
  year = {1986},
  publisher = {{CSIRO} Publishing},
  volume = {34},
  number = {3},
  pages = {231},
  author = {J. R. Dodson},
  title = {Holocene Vegetation and Environments Near Goulburn, New South Wales},
  journal = {Australian Journal of Botany},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{dodson1986holocenevegetationandenvironmentsneargoulburnnewsouthwalesaustralianjournalofbotany34231249,
  doi = {10.1071/bt9860231},
  url = {https://doi.org/10.1071/bt9860231},
  year = {1986},
  publisher = {{CSIRO} Publishing},
  volume = {34},
  number = {3},
  pages = {231},
  author = {J. R. Dodson},
  title = {Holocene Vegetation and Environments Near Goulburn, New South Wales},
  journal = {Australian Journal of Botany},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{kershaw1975stratigraphyandpollenanalysisofbromfieldswampnortheasternqueenslandaustralia,
  doi = {10.1111/j.1469-8137.1975.tb01385.x},
  url = {https://doi.org/10.1111/j.1469-8137.1975.tb01385.x},
  year = {1975},
  month = {jul},
  publisher = {Wiley},
  volume = {75},
  number = {1},
  pages = {173--191},
  author = {A. P. Kershaw},
  title = {Stratigraphy and Pollen Analysis of Bromfield Swamp, North Eastern Queensland, Australia},
  journal = {New Phytologist},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{delcourt1983a12000yearrecordofforesthistoryformcahabapondstclaircountyalabamaecologicalarchivese064003,
  doi = {10.2307/1937210},
  url = {http://dx.doi.org/10.2307/1937210},
  year = {1983},
  month = {aug},
  publisher = {Wiley},
  volume = {64},
  number = {4},
  pages = {874–887},
  author = {Hazel R. Delcourt and Paul A. Delcourt and Elliott C. Spiker},
  title = {A 12 000‐Year Record of Forest History form Cahaba Pond, St. Clair County, Alabama: Ecological Archives E064-003},
  journal = {Ecology},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{delcourt1983a12000yearrecordofforesthistoryformcahabapondstclaircountyalabama,
  doi = {10.2307/1937210},
  url = {https://doi.org/10.2307/1937210},
  year = {1983},
  month = {aug},
  publisher = {Wiley},
  volume = {64},
  number = {4},
  pages = {874--887},
  author = {Hazel R. Delcourt and Paul A. Delcourt and Elliott C. Spiker},
  title = {A 12 000-Year Record of Forest History form Cahaba Pond, St. Clair County, Alabama},
  journal = {Ecology},
}

@Article{delcourt1983a12000yearrecordofforesthistoryfromcahabapondstclaircountyalabamaecology64874887,
  doi = {10.2307/1937210},
  url = {https://doi.org/10.2307/1937210},
  year = {1983},
  month = {aug},
  publisher = {Wiley},
  volume = {64},
  number = {4},
  pages = {874--887},
  author = {Hazel R. Delcourt and Paul A. Delcourt and Elliott C. Spiker},
  title = {A 12 000-Year Record of Forest History form Cahaba Pond, St. Clair County, Alabama},
  journal = {Ecology},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{barnosky1985latequaternaryvegetationinthesouthwesterncolumbiabasinwashington,
  doi = {10.1016/0033-5894(85)90075-4},
  url = {https://doi.org/10.1016/0033-5894(85)90075-4},
  year = {1985},
  month = {jan},
  publisher = {Cambridge University Press ({CUP})},
  volume = {23},
  number = {1},
  pages = {109--122},
  author = {Cathy W. Barnosky},
  title = {Late Quaternary Vegetation in the Southwestern Columbia Basin, Washington},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{adams2019lateholocenepaleohydrologyofwalkerlakeandthecarsonsinkinthewesterngreatbasinnevadausa,
  doi = {10.1017/qua.2018.151},
  url = {https://doi.org/10.1017/qua.2018.151},
  year = {2019},
  month = {mar},
  publisher = {Cambridge University Press ({CUP})},
  volume = {92},
  number = {1},
  pages = {165--182},
  author = {Kenneth D. Adams and Edward J. Rhodes},
  title = {Late Holocene paleohydrology of Walker Lake and the Carson Sink in the western Great Basin, Nevada, USA},
  journal = {Quaternary Research},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{buckley1970isotopesradiocarbonmeasurementsviii,
  doi = {10.1017/s0033822200036225},
  url = {https://doi.org/10.1017/s0033822200036225},
  year = {1970},
  publisher = {Cambridge University Press ({CUP})},
  volume = {12},
  number = {1},
  pages = {87--129},
  author = {James D. Buckley and Eric H. Willis},
  title = {Isotopes Radiocarbon Measurements VIII},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{chamard1973monographiedunesebkhacontinentaledusudouestsaharienlaritaniebulletindelinstitutfrancaisdafriquenoiresenegal35a207243,
  year = {1973},
  author = {Ph.C. Chamard},
  title = {Monographie d'une sebkha continentale du sud-ouest saharien : la sebkha de Chemchane (Adrar deMauritanie). Bulletin de l'Institut francaisd'Afrique noire, Senegal 35A : 207-243.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{xu2020juxtapositionofwesternpacificsubtropicalhighonasiansummermonsoonshapessubtropicaleastasianprecipitation,
  doi = {10.1029/2019gl084705},
  url = {https://doi.org/10.1029/2019gl084705},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {Hai Xu and Yonaton Goldsmith and Jianghu Lan and Liangcheng Tan and Xulong Wang and Xinying Zhou and Jun Cheng and Yunchao Lang and Congqiang Liu},
  title = {Juxtaposition of Western Pacific Subtropical High on Asian Summer Monsoon Shapes Subtropical East Asian Precipitation},
  journal = {Geophysical Research Letters},
}

@Article{stager1988environmentalchangesatlakecheshizambiasince40000yearsbpquaternaryresearch295465,
  doi = {10.1016/0033-5894(88)90071-3},
  url = {https://doi.org/10.1016/0033-5894(88)90071-3},
  year = {1988},
  month = {jan},
  publisher = {Cambridge University Press ({CUP})},
  volume = {29},
  number = {1},
  pages = {54--65},
  author = {J. Curt Stager},
  title = {Environmental Changes at Lake Cheshi, Zambia Since 40,000 Years B.P.},
  journal = {Quaternary Research},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{metcalfe1991palaeolimnologyoftheupperlermabasincentralmexicoarecordofclimaticchangeandanthropogenicdisturbancesince11600yrbp,
  doi = {10.1007/bf00200345},
  url = {https://doi.org/10.1007/bf00200345},
  year = {1991},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {5},
  number = {3},
  author = {SarahE. Metcalfe and F.Alayne Street-Perrott and R.Alan Perrott and DouglasD. Harkness},
  title = {Palaeolimnology of the Upper Lerma Basin, Central Mexico: a record of climatic change and anthropogenic disturbance since 11 600 yr BP},
  journal = {Journal of Paleolimnology},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{damon1964arizonaradiocarbondatesv,
  doi = {10.1017/s0033822200010560},
  url = {https://doi.org/10.1017/s0033822200010560},
  year = {1964},
  publisher = {Cambridge University Press ({CUP})},
  volume = {6},
  pages = {91--107},
  author = {Paul E. Damon and C. Vance Haynes and Austin Long},
  title = {Arizona Radiocarbon Dates V},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{goldsmith2017northwardextentofeastasianmonsooncovarieswithintensityonorbitalandmillennialtimescales,
  doi = {10.1073/pnas.1616708114},
  url = {https://doi.org/10.1073/pnas.1616708114},
  year = {2017},
  month = {feb},
  publisher = {Proceedings of the National Academy of Sciences},
  volume = {114},
  number = {8},
  pages = {1817--1821},
  author = {Yonaton Goldsmith and Wallace S. Broecker and Hai Xu and Pratigya J. Polissar and Peter B. deMenocal and Naomi Porat and Jianghu Lan and Peng Cheng and Weijian Zhou and Zhisheng An},
  title = {Northward extent of East Asian monsoon covaries with intensity on orbital and millennial timescales},
  journal = {Proceedings of the National Academy of Sciences},
}

@Article{singh1972stratigraphicandradiocarbonevidencefortheageanddevelopmentofthreesaltlakedepositsinrajasthanindia,
  doi = {10.1016/0033-5894(72)90088-9},
  url = {https://doi.org/10.1016/0033-5894(72)90088-9},
  year = {1972},
  month = {dec},
  publisher = {Cambridge University Press ({CUP})},
  volume = {2},
  number = {4},
  pages = {496--505},
  author = {Gurdip Singh and R.D. Joshi and A.B. Singh},
  title = {Stratigraphic and Radiocarbon Evidence for the Age and Development of Three Salt Lake Deposits in Rajasthan, India},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{fontes1973phaseshumidesaupleistocenesuperieuretalholocenedanslesfaicomptesrendushebdomadairesdelacademiedessciencesparis2771973,
  year = {1973},
  author = {J-C Fontes and P. Pouchan C. Moussie and M. Weidmann},
  title = {Phases humides au Pleistocene superieur et al'Holocene dans le sud de l'Afar (T.F.A.I.).Comptes rendus hebdomadaires de l'Academie desSciences, Paris 277 : 1973},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{winkler1985a12000yearhistoryofvegetationandclimateforcapecodmassachusetts,
  doi = {10.1016/0033-5894(85)90037-7},
  url = {https://doi.org/10.1016/0033-5894(85)90037-7},
  year = {1985},
  month = {may},
  publisher = {Cambridge University Press ({CUP})},
  volume = {23},
  number = {3},
  pages = {301--312},
  author = {Marjorie Green Winkler},
  title = {A 12,000-Year History of Vegetation and Climate for Cape Cod, Massachusetts},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{winkler1985a12000yearhistoryofvegetationandclimateforcapecodmassachusettsquaternaryresearch23301312,
  doi = {10.1016/0033-5894(85)90037-7},
  url = {https://doi.org/10.1016/0033-5894(85)90037-7},
  year = {1985},
  month = {may},
  publisher = {Cambridge University Press ({CUP})},
  volume = {23},
  number = {3},
  pages = {301--312},
  author = {Marjorie Green Winkler},
  title = {A 12,000-Year History of Vegetation and Climate for Cape Cod, Massachusetts},
  journal = {Quaternary Research},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{shuman2017patternsofhydroclimaticchangeintherockymountainsandsurroundingregionssincethelastglacialmaximum,
  doi = {10.1016/j.quascirev.2017.08.012},
  url = {https://doi.org/10.1016/j.quascirev.2017.08.012},
  year = {2017},
  month = {oct},
  publisher = {Elsevier {BV}},
  volume = {173},
  pages = {58--77},
  author = {Bryan N. Shuman and Marc Serravezza},
  title = {Patterns of hydroclimatic change in the Rocky Mountains and surrounding regions since the last glacial maximum},
  journal = {Quaternary Science Reviews},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{schrevebrinkman1978apalynologicalstudyoftheupperquaternarysequenterscolombiapalaeogeographypalaeoclimatologypalaeoecology251109,
  doi = {10.1016/0031-0182(78)90074-3},
  url = {https://doi.org/10.1016/0031-0182(78)90074-3},
  year = {1978},
  month = {sep},
  publisher = {Elsevier {BV}},
  volume = {25},
  number = {1-2},
  pages = {1--109},
  author = {Elisabeth J. Schreve-Brinkman},
  title = {A palynological study of the upper quaternary sequence in the El Abra corridor and rock shelters (Colombia)},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{melief1983thepalynologyofpeatandlakedepositsinthecordilleracentraternarypaleoecologyoftheparquenacionalnaturallosnecadoscordill,
  year = {1983},
  author = {A.B.M. Melief and M.A. {van de Wijngaard}},
  title = {The palynology of peat and lake deposits in theCordillera Central: Laguna verde de la SieteCabezas. In: "Late Quaternary paleoecology of the Parque Nacional Natural los Necados (Cordill},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{shuman2014anorthsouthmoisturedipoleatmulticenturyscalesinthecentralandsouthernrockymountainsusaduringthelateholocene,
  doi = {10.2113/gsrocky.49.1.33},
  url = {https://doi.org/10.2113/gsrocky.49.1.33},
  year = {2014},
  month = {mar},
  publisher = {Rocky Mountain Geology, University of Wyoming},
  volume = {49},
  number = {1},
  pages = {33--49},
  author = {B. N. Shuman and G. E. Carter and D. D. Hougardy and K. Powers and J. J. Shinker},
  title = {A north-south moisture dipole at multi-century scales in the Central and Southern Rocky Mountains, U.S.A., during the late Holocene},
  journal = {Rocky Mountain Geology},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{bottcher1972quartareseebildungenundihremolluskeninhalteimtibestigebirge,
  year = {1972},
  pages = {16 : 182-234.},
  author = {U Bottcher and S.H. Jaeckel P-J. Ergenzinger and {K.Kaiser}},
  title = {Quartare Seebildungen und ihre Mollusken Inhalteim Tibesti-Gebirge},
  journal = {Zeitschrift fur Geomorphologie},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{delibrias1966gifnaturalradiocarbonmeasurementsii,
  doi = {10.1017/s0033822200000060},
  url = {https://doi.org/10.1017/s0033822200000060},
  year = {1966},
  publisher = {Cambridge University Press ({CUP})},
  volume = {8},
  pages = {74--95},
  author = {G. Delibrias and M. T. Guillier and J. Labeyrie},
  title = {Gif Natural Radiocarbon Measurements II},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{delibrias1966gifnaturalradiocarbonmeasurementsiiradiocarbon892,
  doi = {10.1017/s0033822200000060},
  url = {https://doi.org/10.1017/s0033822200000060},
  year = {1966},
  publisher = {Cambridge University Press ({CUP})},
  volume = {8},
  pages = {74--95},
  author = {G. Delibrias and M. T. Guillier and J. Labeyrie},
  title = {Gif Natural Radiocarbon Measurements II},
  journal = {Radiocarbon},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{gilman1975stephenfbedwellfortrockbasinprehistoryandenvironmenteugeneuniversityoforegonbooks1973205pp4pls43figs1map21tables1000,
  doi = {10.1017/s0003598x00063420},
  url = {http://dx.doi.org/10.1017/S0003598X00063420},
  year = {1975},
  month = {mar},
  publisher = {Cambridge University Press (CUP)},
  volume = {49},
  number = {193},
  pages = {77–78},
  author = {Antonio Gilman},
  title = {Stephen F. Bedwell: Fort Rock Basin, prehistory and environment. Eugene: University of Oregon Books, 1973. 205 pp., 4 pls., 43 figs., 1 map, 21 tables. $10.00.},
  journal = {Antiquity},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{gilman1975stephenfbedwellfortrockbasinprehistoryandenvironmenteursityoforegonbooks1973205pp4pls43figs1map21tablestextdollar1000,
  doi = {10.1017/s0003598x00063420},
  url = {https://doi.org/10.1017/s0003598x00063420},
  year = {1975},
  month = {mar},
  publisher = {Cambridge University Press ({CUP})},
  volume = {49},
  number = {193},
  pages = {77--78},
  author = {Antonio Gilman},
  title = {Stephen F. Bedwell: Fort Rock Basin, prehistory and environment. Eugene: University of Oregon Books, 1973. 205 pp., 4 pls., 43 figs., 1 map, 21 tables.},
  journal = {Antiquity},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{bowler1986radiocarbondatingofplayalakehydrologicchangesexamplesfromnorthwesternchinaandcentralaustralia,
  doi = {10.1016/0031-0182(86)90127-6},
  url = {https://doi.org/10.1016/0031-0182(86)90127-6},
  year = {1986},
  month = {may},
  publisher = {Elsevier {BV}},
  volume = {54},
  number = {1-4},
  pages = {241--260},
  author = {J.M. Bowler and Huang Qi and Chen Kezao and M.J. Head and Yuan Baoyin},
  title = {Radiocarbon dating of playa-lake hydrologic changes: Examples from northwestern China and central Australia},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{bowler1986radiocarbondatingofplayalakehydrologicchangesexamplesfndcentralaustraliapalaeogeographypalaeoclimatologypalaeoecology,
  doi = {10.1016/0031-0182(86)90127-6},
  url = {https://doi.org/10.1016/0031-0182(86)90127-6},
  year = {1986},
  month = {may},
  publisher = {Elsevier {BV}},
  volume = {54},
  number = {1-4},
  pages = {241--260},
  author = {J.M. Bowler and Huang Qi and Chen Kezao and M.J. Head and Yuan Baoyin},
  title = {Radiocarbon dating of playa-lake hydrologic changes: Examples from northwestern China and central Australia},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{vangeel1973upperquaternaryvegetationandclimaticsequenceofthefuqulleracolombiapalaeogeographypalaeoclimatologypalaeoecology14992,
  doi = {10.1016/0031-0182(73)90064-3},
  url = {https://doi.org/10.1016/0031-0182(73)90064-3},
  year = {1973},
  month = {aug},
  publisher = {Elsevier {BV}},
  volume = {14},
  number = {1},
  pages = {9--92},
  author = {B. {Van Geel} and T. Van {der Hammen}},
  title = {Upper quaternary vegetational and climatic sequence of the fuquene area (Eastern Cordillera, Colombia)},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{bowler1976latequaternaryclimatesofaustraliaandnewguinea,
  doi = {10.1016/0033-5894(67)90003-8},
  url = {https://doi.org/10.1016/0033-5894(67)90003-8},
  year = {1976},
  month = {sep},
  publisher = {Cambridge University Press ({CUP})},
  volume = {6},
  number = {3},
  pages = {359--394},
  author = {J.M. Bowler and G.S. Hope and J.N. Jennings and G. Singh and D. Walker},
  title = {Late Quaternary Climates of Australia and New Guinea},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{hutchinson1981thesedimentaryframeworkofthesouthernbasinoflakegeorgenewyork,
  doi = {10.1016/0033-5894(81)90113-7},
  url = {https://doi.org/10.1016/0033-5894(81)90113-7},
  year = {1981},
  month = {jan},
  publisher = {Cambridge University Press ({CUP})},
  volume = {15},
  number = {1},
  pages = {44--61},
  author = {D.R. Hutchinson and W.M. Ferrebee and H.J. Knebel and R.J. Wold and Y.W. Isachsen},
  title = {The Sedimentary Framework of the Southern Basin of Lake George, New York},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{delibrias1971gifnaturalradiocarbonmeasurementsviradiocarbon13223,
  doi = {10.1017/s0033822200008444},
  url = {https://doi.org/10.1017/s0033822200008444},
  year = {1971},
  publisher = {Cambridge University Press ({CUP})},
  volume = {13},
  number = {2},
  pages = {213--254},
  author = {G. Delibrias and M. T. Guillier and J. Labeyrie},
  title = {GIF Natural Radiocarbon Measurements VI},
  journal = {Radiocarbon},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{haynesjr1983pastvegetationandclimateofthemogollonrimareaarizonaphdthesisuniversityofarizonatucson166pp,
  year = {1983},
  author = {C.V {Haynes Jr} and J.C. Ritchie and C.H. Eyles},
  title = {Past Vegetation and Climate of the Mogollon RimArea, Arizona. Ph.D. thesis, University ofArizona, Tucson, 166pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{steventon1985universityofwisconsinradiocarbondatesxxii,
  doi = {10.1017/s0033822200007141},
  url = {https://doi.org/10.1017/s0033822200007141},
  year = {1985},
  publisher = {Cambridge University Press ({CUP})},
  volume = {27},
  number = {2B},
  pages = {455--469},
  author = {Raymond L Steventon and John E Kutzbach},
  title = {University of Wisconsin Radiocarbon Dates XXII},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{winkler1985lateglacialandholoceneenvironmentalhistoryofsouthcentlandecosystemsphdthesisuniversityofwisconsinmadisonmadison261pp,
  year = {1985},
  author = {M.G. Winkler},
  title = {Late-Glacial and Holocene Environmental History of South-Central Wisconsin : A Study of Upland and Wetland Ecosystems. Ph.D. thesis, University of Wisconsin-Madison, Madison, 261pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{heusser1983personalcommunication,
  year = {1983},
  author = {C.J. Heusser},
  title = {Personal communication.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{jacobs1983pastvegetationandclimateofthemogollonrimareaarizonaphdthesisuniversityofarizonatucson166pp,
  year = {1983},
  author = {B.F. Jacobs},
  title = {Past Vegetation and Climate of the Mogollon RimArea, Arizona. Ph.D. thesis, University ofArizona, Tucson, 166pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{gerlach1972sedimentslacustrespostglaciairesdansladepressiondejaslosanokstudiageomorphologicacarpathobalcania63761,
  year = {1972},
  author = {T Gerlach and W. Koperowa L. Koszarski and E. Koster},
  title = {Sediments lacustres postglaciaires dans ladepression de Jaslo-Sanok. Studia Geomorphologica Carpatho-Balcania 6 : 37-61.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{collins1968implicationsofdiatomsuccessioninpostglacialsedimentsfromtwositesinnortherniowaphdthesisiowastateuniversityames197pp,
  year = {1968},
  author = {G.B. Collins},
  title = {Implications of Diatom Succession in Post-Glacial Sediments from Two Sites in Northern Iowa. Ph.D. thesis, Iowa State University, Ames, 197pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{brugam1980postglacialdiatomstratigraphyofkirchnermarshminnesota,
  doi = {10.1016/0033-5894(80)90087-3},
  url = {https://doi.org/10.1016/0033-5894(80)90087-3},
  year = {1980},
  month = {jan},
  publisher = {Cambridge University Press ({CUP})},
  volume = {13},
  number = {1},
  pages = {133--146},
  author = {Richard B. Brugam},
  title = {Postglacial Diatom Stratigraphy of Kirchner Marsh, Minnesota},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{haberyan1987thelatepleistoceneandholocenestratigraphyandpaleolimnologyoflakeskivuandtanganyika,
  doi = {10.1016/0031-0182(87)90048-4},
  url = {https://doi.org/10.1016/0031-0182(87)90048-4},
  year = {1987},
  month = {jan},
  publisher = {Elsevier {BV}},
  volume = {61},
  pages = {169--197},
  author = {Kurt A. Haberyan and Robert E. Hecky},
  title = {The late Pleistocene and Holocene stratigraphy and paleolimnology of Lakes Kivu and Tanganyika},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{macumber1977thegeologyandpaleohydrologyofthekowswampjournalofthegeologicalsocietyofaustralia,
  doi = {10.1080/00167617708728990},
  url = {https://doi.org/10.1080/00167617708728990},
  year = {1977},
  month = {sep},
  publisher = {Informa UK Limited},
  volume = {24},
  number = {5-6},
  pages = {307--320},
  author = {P. G. Macumber},
  title = {The geology and palaeohydrology of the Kow Swamp fossil hominid site, Victoria, Australia},
  journal = {Journal of the Geological Society of Australia},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{melief1984thepalynologyofpeatandlakedepositsinthecordilleracentraternarypaleoecologyoftheparquenacionalnaturallosnecadoscordill,
  year = {1984},
  author = {A.B.M. Melief and M.A. {van de Wijngaard}},
  title = {The palynology of peat and lake deposits in theCordillera Central: Laguna verde de la SieteCabezas. In: "Late Quaternary paleoecology of the Parque Nacional Natural los Necados (Cordill},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{waters1989latequaternarylacustrinehistoryandpaleoclimaticsignificanceofpluviallakecochisesoutheasternarizona,
  doi = {10.1016/0033-5894(89)90027-6},
  url = {https://doi.org/10.1016/0033-5894(89)90027-6},
  year = {1989},
  month = {jul},
  publisher = {Cambridge University Press ({CUP})},
  volume = {32},
  number = {1},
  pages = {1--11},
  author = {Michael R. Waters},
  title = {Late Quaternary Lacustrine History and Paleoclimatic Significance of Pluvial Lake Cochise, Southeastern Arizona},
  journal = {Quaternary Research},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{pribyl2014acomputationalapproachtoquaternarylakelevelreconstructionappliedinthecentralrockymountainswyomingusa,
  doi = {10.1016/j.yqres.2014.01.012},
  url = {https://doi.org/10.1016/j.yqres.2014.01.012},
  year = {2014},
  month = {jul},
  publisher = {Cambridge University Press ({CUP})},
  volume = {82},
  number = {1},
  pages = {249--259},
  author = {Paul Pribyl and Bryan N. Shuman},
  title = {A computational approach to Quaternary lake-level reconstruction applied in the central Rocky Mountains, Wyoming, USA},
  journal = {Quaternary Research},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{vanzant1979lateglacialandpostglacialpollenandplantmacrofossilsfromlakewestokobojinorthwesterniowa,
  doi = {10.1016/0033-5894(79)90034-6},
  url = {http://dx.doi.org/10.1016/0033-5894(79)90034-6},
  year = {1979},
  month = {nov},
  publisher = {Cambridge University Press (CUP)},
  volume = {12},
  number = {3},
  pages = {358–380},
  author = {Kent {Van Zant}},
  title = {Late Glacial and Postglacial Pollen and Plant Macrofossils from Lake West Okoboji, Northwestern Iowa},
  journal = {Quaternary Research},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{zant1979lateglacialandpostglacialpollenandplantmacrofossilsfromlakewestokobojinorthwesterniowa,
  doi = {10.1016/0033-5894(79)90034-6},
  url = {https://doi.org/10.1016/0033-5894(79)90034-6},
  year = {1979},
  month = {nov},
  publisher = {Cambridge University Press ({CUP})},
  volume = {12},
  number = {3},
  pages = {358--380},
  author = {Kent {Van Zant}},
  title = {Late Glacial and Postglacial Pollen and Plant Macrofossils from Lake West Okoboji, Northwestern Iowa},
  journal = {Quaternary Research},
}

@Article{crane1958universityofmichiganradiocarbondatesiii,
  doi = {10.1126/science.128.3332.1117},
  url = {https://doi.org/10.1126/science.128.3332.1117},
  year = {1958},
  month = {nov},
  publisher = {American Association for the Advancement of Science ({AAAS})},
  volume = {128},
  number = {3332},
  pages = {1117--1123},
  author = {H. R Crane and James B. Griffin},
  title = {University of Michigan Radiocarbon Dates III},
  journal = {Science},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{crane1958universityofmichiganradiocarbondatesiiiscience12811171123,
  doi = {10.1126/science.128.3332.1117},
  url = {https://doi.org/10.1126/science.128.3332.1117},
  year = {1958},
  month = {nov},
  publisher = {American Association for the Advancement of Science ({AAAS})},
  volume = {128},
  number = {3332},
  pages = {1117--1123},
  author = {H. R Crane and James B. Griffin},
  title = {University of Michigan Radiocarbon Dates III},
  journal = {Science},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{kaufman1971useriesdatingofdeadseabasincarbonates,
  doi = {10.1016/0016-7037(71)90115-3},
  url = {https://doi.org/10.1016/0016-7037(71)90115-3},
  year = {1971},
  month = {dec},
  publisher = {Elsevier {BV}},
  volume = {35},
  number = {12},
  pages = {1269--1281},
  author = {Aaron Kaufman},
  title = {U-Series dating of Dead Sea Basin carbonates},
  journal = {Geochimica et Cosmochimica Acta},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{bedwell1973prehistoryandenvironment,
  year = {1973},
  author = {S.F. Bedwell},
  title = {Prehistory and Environment},
  journal = {University of Oregon Press, Eugene},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{pribyl2014acomputationalapproachtoquaternarylakelevelreconstructionappliedinthecentralrockymountainswyomingusa,
  doi = {10.1016/j.yqres.2014.01.012},
  url = {https://doi.org/10.1016/j.yqres.2014.01.012},
  year = {2014},
  month = {jul},
  publisher = {Cambridge University Press ({CUP})},
  volume = {82},
  number = {1},
  pages = {249--259},
  author = {Paul Pribyl and Bryan N. Shuman},
  title = {A computational approach to Quaternary lake-level reconstruction applied in the central Rocky Mountains, Wyoming, USA},
  journal = {Quaternary Research},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{holliday1985morphologyoflateholocenesoilsatthelubbocklakearcheologicalsitetexas,
  doi = {10.2136/sssaj1985.03615995004900040030x},
  url = {https://doi.org/10.2136/sssaj1985.03615995004900040030x},
  year = {1985},
  month = {jul},
  publisher = {Wiley},
  volume = {49},
  number = {4},
  pages = {938--946},
  author = {Vance T. Holliday},
  title = {Morphology of Late Holocene Soils at the Lubbock Lake Archeological Site, Texas},
  journal = {Soil Science Society of America Journal},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{singh1972stratigraphicandradiocarbonevidencefortheageanddevelopmfthreesaltlakedepositsinrajasthanindiaquaternaryresearch2496505,
  doi = {10.1016/0033-5894(72)90088-9},
  url = {https://doi.org/10.1016/0033-5894(72)90088-9},
  year = {1972},
  month = {dec},
  publisher = {Cambridge University Press ({CUP})},
  volume = {2},
  number = {4},
  pages = {496--505},
  author = {Gurdip Singh and R.D. Joshi and A.B. Singh},
  title = {Stratigraphic and Radiocarbon Evidence for the Age and Development of Three Salt Lake Deposits in Rajasthan, India},
  journal = {Quaternary Research},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{kershaw1974alongcontinuouspollensequencefromnortheasternaustralia,
  doi = {10.1038/251222a0},
  url = {https://doi.org/10.1038/251222a0},
  year = {1974},
  month = {sep},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {251},
  number = {5472},
  pages = {222--223},
  author = {A. P. Kershaw},
  title = {A long continuous pollen sequence from north-eastern Australia},
  journal = {Nature},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{kershaw1974alongcontinuouspollensequencefromnortheasternaustralianature251222223,
  doi = {10.1038/251222a0},
  url = {https://doi.org/10.1038/251222a0},
  year = {1974},
  month = {sep},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {251},
  number = {5472},
  pages = {222--223},
  author = {A. P. Kershaw},
  title = {A long continuous pollen sequence from north-eastern Australia},
  journal = {Nature},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{butzer1972radiocarbondatingofeastafricanlakelevelsnewobservationsprovidefreshinsightsintolatequaternarypaleoclimates,
  doi = {10.1126/science.175.4026.1069},
  url = {http://dx.doi.org/10.1126/science.175.4026.1069},
  year = {1972},
  month = {mar},
  publisher = {American Association for the Advancement of Science (AAAS)},
  volume = {175},
  number = {4026},
  pages = {1069–1076},
  author = {Karl W. Butzer and Glynn L. Isaac and Jonathan L. Richardson and Celia Washbourn-Kamau},
  title = {Radiocarbon Dating of East African Lake Levels: New observations provide fresh insights into late Quaternary paleoclimates.},
  journal = {Science},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{butzer1972radiocarbondatingofeastafricanlakelevels,
  doi = {10.1126/science.175.4026.1069},
  url = {https://doi.org/10.1126/science.175.4026.1069},
  year = {1972},
  month = {mar},
  publisher = {American Association for the Advancement of Science ({AAAS})},
  volume = {175},
  number = {4026},
  pages = {1069--1076},
  author = {Karl W. Butzer and Glynn L. Isaac and Jonathan L. Richardson and Celia Washbourn-Kamau},
  title = {Radiocarbon Dating of East African Lake Levels},
  journal = {Science},
}

@Article{butzer1972radiocarbondatingofeastafricanlakelevelsscience17510691076,
  doi = {10.1126/science.175.4026.1069},
  url = {https://doi.org/10.1126/science.175.4026.1069},
  year = {1972},
  month = {mar},
  publisher = {American Association for the Advancement of Science ({AAAS})},
  volume = {175},
  number = {4026},
  pages = {1069--1076},
  author = {Karl W. Butzer and Glynn L. Isaac and Jonathan L. Richardson and Celia Washbourn-Kamau},
  title = {Radiocarbon Dating of East African Lake Levels},
  journal = {Science},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{durand1984lenordouestdulactchadauquaternaireetudedepaleoenvironnementsalluviauxeolienspalustresetlacustrespalaeoecologyofafrica,
  year = {1984},
  author = {A Durand and M. Icole J-Ch. Fontes F. Gasse and {J.Lang}},
  title = {Le nord-ouest du lac Tchad au Quaternaire : Etude de paleoenvironnements alluviaux, eoliens,palustres et lacustres. Palaeoecology of Africa},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{newby200014000yearsofsedimentvegetationandwaterlevelchangesatthemakepeacecedarswampsoutheasternmassachusetts,
  doi = {10.1006/qres.1999.2120},
  url = {https://doi.org/10.1006/qres.1999.2120},
  year = {2000},
  month = {may},
  publisher = {Cambridge University Press ({CUP})},
  volume = {53},
  number = {3},
  pages = {352--368},
  author = {Paige E. Newby and Peter Killoran and Mahlon R. Waldorf and Bryan N. Shuman and Robert S. Webb and Thompson Webb},
  title = {14,000 Years of Sediment, Vegetation, and Water-Level Changes at the Makepeace Cedar Swamp, Southeastern Massachusetts},
  journal = {Quaternary Research},
}

@Article{shuman2004evidenceforthecloseclimaticcontrolofnewenglandvegetationhistory,
  doi = {10.1890/02-0286},
  url = {https://doi.org/10.1890/02-0286},
  year = {2004},
  month = {may},
  publisher = {Wiley},
  volume = {85},
  number = {5},
  pages = {1297--1310},
  author = {Bryan Shuman and Paige Newby and Yongsong Huang and Thompson Webb},
  title = {Evidence for the Close Climatic Control of New England Vegetation History},
  journal = {Ecology},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{white1982holocenevegetationandclimaticchangeinthepeaceriverdistrictcanada,
  doi = {10.1139/e82-045},
  url = {https://doi.org/10.1139/e82-045},
  year = {1982},
  month = {mar},
  publisher = {Canadian Science Publishing},
  volume = {19},
  number = {3},
  pages = {555--570},
  author = {James M. White and Rolf W. Mathewes},
  title = {Holocene vegetation and climatic change in the Peace River district, Canada},
  journal = {Canadian Journal of Earth Sciences},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{steventon1986universityofwisconsinradiocarbondatesxxiii,
  doi = {10.1017/s003382220002021x},
  url = {https://doi.org/10.1017/s003382220002021x},
  year = {1986},
  publisher = {Cambridge University Press ({CUP})},
  volume = {28},
  number = {3},
  pages = {1206--1223},
  author = {Raymond L Steventon and John E Kutzbach},
  title = {University of Wisconsin Radiocarbon Dates XXIII},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{bradbury1971paleolimnologyoflaketexcocomexicoevidencefromdiatoms1,
  doi = {10.4319/lo.1971.16.2.0180},
  url = {https://doi.org/10.4319/lo.1971.16.2.0180},
  year = {1971},
  month = {mar},
  publisher = {Wiley},
  volume = {16},
  number = {2},
  pages = {180--200},
  author = {John P. Bradbury},
  title = {Paleolimnology of Lake Texcoco, Mexico. Evidence from DIATOMS1},
  journal = {Limnology and Oceanography},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{bradbury1971paleolimnologyoflaketexcocomexicoevidencefromdiatoms,
  doi = {10.4319/lo.1971.16.2.0180},
  url = {https://doi.org/10.4319/lo.1971.16.2.0180},
  year = {1971},
  month = {mar},
  publisher = {Wiley},
  volume = {16},
  number = {2},
  pages = {180--200},
  author = {John P. Bradbury},
  title = {Paleolimnology of Lake Texcoco, Mexico. Evidence from DIATOMS1},
  journal = {Limnology and Oceanography},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{harvey1976thepaleolimnologyoflakemobutusesesekougandazairethelast28000yearsphdthesisdukeuniversitydurhamnorthcarolina113pp,
  year = {1976},
  author = {T.J. Harvey},
  title = {The Paleolimnology of Lake Mobutu Sese Seko,Uganda-Zaire : the Last 28,000 Years. Ph.D.thesis, Duke University, Durham, North Carolina,113pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{schweger1983lateglacialholoceneclimaticchangesofalbertatherecordclimaticfluctuationsonalbertasresourcesandenvironmentpp4760atmo,
  year = {1983},
  author = {C Schweger and T. Habgood and M. Hickman},
  title = {Late Glacial-Holocene climatic changes of Alberta : the record from lake sediment studies. In : "The Impacts of Climatic Fluctuations on Alberta'sResources and Environment.", pp 47-60. Atmo},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{wendorf1976theprehistoryoftheegyptiansahara,
  doi = {10.1126/science.193.4248.103},
  url = {https://doi.org/10.1126/science.193.4248.103},
  year = {1976},
  month = {jul},
  publisher = {American Association for the Advancement of Science ({AAAS})},
  volume = {193},
  number = {4248},
  pages = {103--114},
  author = {Fred Wendorf and Romuald Schild and Rushdi Said and C. Vance Haynes and Achiel Gautier and Michal Kobusiewicz},
  title = {The Prehistory of the Egyptian Sahara},
  journal = {Science},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{wendorf1980prehistoryoftheeasternsaharaacademicpressnewyork404pp,
  year = {1980},
  author = {F. Wendorf and R. Schild},
  title = {Prehistory of the Eastern Sahara. AcademicPress, New York, 404pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{vanzant1979lateglacialandpostglacialpollenandplantmacrofossilsfromlakewestokobojinorthwesterniowa,
  doi = {10.1016/0033-5894(79)90034-6},
  url = {http://dx.doi.org/10.1016/0033-5894(79)90034-6},
  year = {1979},
  month = {nov},
  publisher = {Cambridge University Press (CUP)},
  volume = {12},
  number = {3},
  pages = {358–380},
  author = {Kent {Van Zant}},
  title = {Late Glacial and Postglacial Pollen and Plant Macrofossils from Lake West Okoboji, Northwestern Iowa},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{zant1979lateglacialandpostglacialpollenandplantmacrofossilsfromlakewestokobojinorthwesterniowa,
  doi = {10.1016/0033-5894(79)90034-6},
  url = {https://doi.org/10.1016/0033-5894(79)90034-6},
  year = {1979},
  month = {nov},
  publisher = {Cambridge University Press ({CUP})},
  volume = {12},
  number = {3},
  pages = {358--380},
  author = {Kent {Van Zant}},
  title = {Late Glacial and Postglacial Pollen and Plant Macrofossils from Lake West Okoboji, Northwestern Iowa},
  journal = {Quaternary Research},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{watts1968pollenseedandmolluskanalysisofasedimentcorefrompickerellakenortheasternsouthdakota,
  doi = {10.1130/0016-7606(1968)79[855:psamao]2.0.co;2},
  url = {https://doi.org/10.1130/0016-7606(1968)79[855:psamao]2.0.co;2},
  year = {1968},
  publisher = {Geological Society of America},
  volume = {79},
  number = {7},
  pages = {855},
  author = {W. A. Watts and R. C. Bright},
  title = {Pollen, Seed, and Mollusk Analysis of a Sediment Core from Pickerel Lake, Northeastern South Dakota},
  journal = {Geological Society of America Bulletin},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{pollard1982waterandpoliticspaleoecologyandthecentralizationofthestract44thinternationalcongressofamericanistsmanchesterpp121122,
  year = {1982},
  author = {P.H. Pollard},
  title = {Water and politics : paleoecology and thecentralization of the Tarascan State. Abstract,44th International Congress of Americanists,Manchester, pp.121-122.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{haworth1972diatomsuccessioninacorefrompickerellakenortheasternsouthdakotageologicalsocietyofamericabulletin83157172,
  doi = {10.1130/0016-7606(1972)83[157:dsiacf]2.0.co;2},
  url = {https://doi.org/10.1130/0016-7606(1972)83[157:dsiacf]2.0.co;2},
  year = {1972},
  publisher = {Geological Society of America},
  volume = {83},
  number = {1},
  pages = {157},
  author = {E. Y. Haworth},
  title = {Diatom Succession in a Core from Pickerel Lake, Northeastern South Dakota},
  journal = {Geological Society of America Bulletin},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{mcglone1978forestdestructionbyearlypolynesianslakepoukawahawkesbaynewzealandjournaloftheroyalsocietyofnewzealand8275281,
  doi = {10.1080/03036758.1978.10429381},
  url = {https://doi.org/10.1080/03036758.1978.10429381},
  year = {1978},
  month = {sep},
  publisher = {Informa UK Limited},
  volume = {8},
  number = {3},
  pages = {275--281},
  author = {M. S. McGlone},
  title = {Forest destruction by early Polynesians, Lake Poukawa, Hawkes Bay, New Zealand},
  journal = {Journal of the Royal Society of New Zealand},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{benson2002holocenemultidecadalandmulticentennialdroughtsaffectingnortherncaliforniaandnevada,
  doi = {10.1016/s0277-3791(01)00048-8},
  url = {https://doi.org/10.1016/s0277-3791(01)00048-8},
  year = {2002},
  month = {feb},
  publisher = {Elsevier {BV}},
  volume = {21},
  number = {4-6},
  pages = {659--682},
  author = {Larry Benson and Michaele Kashgarian and Robert Rye and Steve Lund and Fred Paillet and Joseph Smoot and Cynthia Kester and Scott Mensing and Dave Meko and Susan Lindstr{\"o}m},
  title = {Holocene multidecadal and multicentennial droughts affecting Northern California and Nevada},
  journal = {Quaternary Science Reviews},
}

@Article{briggs2005latepleistoceneandlateholocenelakehighstandsinthepyramidlakesubbasinoflakelahontannevadausa,
  doi = {10.1016/j.yqres.2005.02.011},
  url = {https://doi.org/10.1016/j.yqres.2005.02.011},
  year = {2005},
  month = {sep},
  publisher = {Cambridge University Press ({CUP})},
  volume = {64},
  number = {2},
  pages = {257--263},
  author = {Richard W. Briggs and Steven G. Wesnousky and Kenneth D. Adams},
  title = {Late Pleistocene and Late Holocene Lake Highstands in the Pyramid Lake Subbasin of Lake Lahontan, Nevada, USA},
  journal = {Quaternary Research},
}

@Article{leyden1984guatemalanforestsynthesisafterpleistocenearidity,
  doi = {10.1073/pnas.81.15.4856},
  url = {https://doi.org/10.1073/pnas.81.15.4856},
  year = {1984},
  month = {aug},
  publisher = {Proceedings of the National Academy of Sciences},
  volume = {81},
  number = {15},
  pages = {4856--4859},
  author = {Barbara W. Leyden},
  title = {Guatemalan forest synthesis after Pleistocene aridity},
  journal = {Proceedings of the National Academy of Sciences},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{deevey1978holoceneforestsandmayadisturbancenearquexillakepetenguatemalapolskiearchiwumhydrobiologii25117129,
  year = {1978},
  author = {E.S. Deevey},
  title = {Holocene forests and Maya disturbance near Quexil Lake, Peten, Guatemala. Polskie ArchiwumHydrobiologii 25 : 117-129.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{shuman2017patternsofhydroclimaticchangeintherockymountainsandsurroundingregionssincethelastglacialmaximum,
  doi = {10.1016/j.quascirev.2017.08.012},
  url = {https://doi.org/10.1016/j.quascirev.2017.08.012},
  year = {2017},
  month = {oct},
  publisher = {Elsevier {BV}},
  volume = {173},
  pages = {58--77},
  author = {Bryan N. Shuman and Marc Serravezza},
  title = {Patterns of hydroclimatic change in the Rocky Mountains and surrounding regions since the last glacial maximum},
  journal = {Quaternary Science Reviews},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{thompson1984latepleistoceneandholoceneenvironmentsinthegreatbasinphdthesisuniversityofarizonatucson256pp,
  year = {1984},
  author = {R.S. Thompson},
  title = {Late Pleistocene and Holocene Environments in the Great Basin. Ph.D. thesis, University of Arizona, Tucson, 256pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{fergusson1962uclaradiocarbondatesi,
  doi = {10.1017/s0033822200036572},
  url = {https://doi.org/10.1017/s0033822200036572},
  year = {1962},
  publisher = {Cambridge University Press ({CUP})},
  volume = {4},
  pages = {109--114},
  author = {G. J. Fergusson and W. F. Libby},
  title = {UCLA Radiocarbon Dates I},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@InCollection{waddington1969astratigraphicrecordofthepolleninfluxtoalakeinthebigwoodsofminnesota,
  doi = {10.1130/spe123-p263},
  url = {https://doi.org/10.1130/spe123-p263},
  year = {1969},
  publisher = {Geological Society of America},
  pages = {263--282},
  author = {Jean C. B. Waddington},
  title = {A Stratigraphic Record of the Pollen Influx to a Lake in the Big Woods of Minnesota},
  booktitle = {Geological Society of America Special Papers},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{winkler1995coastalmassachusettsponddevelopmentedaphicclimaticandsealevelimpactssincedeglaciation,
  doi = {10.1007/bf00682431},
  url = {https://doi.org/10.1007/bf00682431},
  year = {1995},
  month = {nov},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {14},
  number = {3},
  pages = {311--336},
  author = {Marjorie Green Winkler and Patricia R. Sanford},
  title = {Coastal Massachusetts pond development: edaphic, climatic, and sea level impacts since deglaciation},
  journal = {Journal of Paleolimnology},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{agrawal1971tatainstituteradiocarbondatelistviii,
  doi = {10.1017/s0033822200000886},
  url = {https://doi.org/10.1017/s0033822200000886},
  year = {1971},
  publisher = {Cambridge University Press ({CUP})},
  volume = {13},
  number = {1},
  pages = {84--93},
  author = {D. P. Agrawal and S. K. Gupta and Sheela Kusumgar},
  title = {Tata Institute Radiocarbon Date List VIII},
  journal = {Radiocarbon},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{flint1958stratigraphyandradiocarbondatesatsearleslakecalifornia,
  doi = {10.2475/ajs.256.10.689},
  url = {https://doi.org/10.2475/ajs.256.10.689},
  year = {1958},
  month = {dec},
  publisher = {American Journal of Science ({AJS})},
  volume = {256},
  number = {10},
  pages = {689--714},
  author = {R. F. Flint and W. A. Gale},
  title = {Stratigraphy and radiocarbon dates at Searles Lake, California},
  journal = {American Journal of Science},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{haynes1979pluviallakesofnorthwesternsudan,
  doi = {10.2307/633212},
  url = {https://doi.org/10.2307/633212},
  year = {1979},
  month = {nov},
  publisher = {{JSTOR}},
  volume = {145},
  number = {3},
  pages = {437},
  author = {C. Vance Haynes and Peter J. Mehringer and El Sayed Abbas Zaghloul},
  title = {Pluvial Lakes of North-Western Sudan},
  journal = {The Geographical Journal},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@InCollection{wells2003latequaternarygeologyandpaleohydrologyofpluviallakemojavesoutherncalifornia,
  doi = {10.1130/0-8137-2368-x.79},
  url = {https://doi.org/10.1130/0-8137-2368-x.79},
  year = {2003},
  publisher = {Geological Society of America},
  author = {Stephen G. Wells and William J. Brown and Yehouda Enzel and Roger Y. Anderson and Leslie D. McFadden},
  title = {Late Quaternary geology and paleohydrology of pluvial Lake Mojave, southern California},
  booktitle = {Paleoenvironments and paleohydrology of the Mojave and southern Great Basin deserts},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{heusser1983quaternarypollenrecordfromlagunadetaguataguachile,
  doi = {10.1126/science.219.4591.1429},
  url = {https://doi.org/10.1126/science.219.4591.1429},
  year = {1983},
  month = {mar},
  publisher = {American Association for the Advancement of Science ({AAAS})},
  volume = {219},
  number = {4591},
  pages = {1429--1432},
  author = {Calvin J. Heusser},
  title = {Quaternary Pollen Record from Laguna de Tagua Tagua, Chile},
  journal = {Science},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{heusser1984personalcommunication,
  year = {1984},
  author = {C.J. Heusser},
  title = {Personal communication.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{servant1978leslacsquaternairesdeshautsplateauxdesandesbolivienneterpretationspaleoclimatiquescahiersdorstomseriegeologique10923,
  year = {1978},
  author = {M. Servant and J-C. Fontes},
  title = {Les lacs quaternaires des hauts plateaux des Andes boliviennes. Premieres interpretationspaleoclimatiques. Cahiers d'ORSTOM Seriegeologique 10 : 9-23.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{faure1963formationslacustresduquaternairesuperieurdunigerorientaolusbulletindubureauderecherchesgeologiquesetminieresparis34163,
  year = {1963},
  author = {H Faure and E. Manguin and R. Nydal},
  title = {Formations lacustres du Quaternaire superieur duNiger oriental : diatomites et ages absolus.Bulletin du Bureau de Recherches geologiques etminieres, Paris 3 : 41-63.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{lambNAan18000yearrecordofvegetationallakelevelandclimaticchangefromthemiddleatlasmoroccojournalofbiogeographysubmitted,
  doi = {10.2307/2845311},
  url = {https://doi.org/10.2307/2845311},
  year = {1989},
  month = {jan},
  publisher = {{JSTOR}},
  volume = {16},
  number = {1},
  pages = {65},
  author = {H. F. Lamb and U. Eicher and V. R. Switsur},
  title = {An 18,000-Year Record of Vegetation, Lake-Level and Climatic Change from Tigalmamine, Middle Atlas, Morocco},
  journal = {Journal of Biogeography},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{burney1987presettlementvegetationchangesatlaketritrivakelymadagascarpalaeoecologyofafrica18357381,
  year = {1987},
  author = {D.A. Burney},
  title = {Pre-settlement vegetation changes at LakeTritrivakely, Madagascar. Palaeoecology of Africa 18 : 357-381.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{bowler1986quaternaryevaporitesandhydrologicalchangeslaketyrrellnorthwestvictoria,
  doi = {10.1080/08120098608729349},
  url = {https://doi.org/10.1080/08120098608729349},
  year = {1986},
  month = {mar},
  publisher = {Informa UK Limited},
  volume = {33},
  number = {1},
  pages = {43--63},
  author = {J. M. Bowler and J. T. Teller},
  title = {Quaternary evaporites and hydrological changes, Lake Tyrrell, North-West Victoria},
  journal = {Australian Journal of Earth Sciences},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{bowler1986quaternaryevaporitesandhydrologicalchangeslaketyrrellnorthwestvictoriaaustralianjournalofearthsciences334363,
  doi = {10.1080/08120098608729349},
  url = {https://doi.org/10.1080/08120098608729349},
  year = {1986},
  month = {mar},
  publisher = {Informa UK Limited},
  volume = {33},
  number = {1},
  pages = {43--63},
  author = {J. M. Bowler and J. T. Teller},
  title = {Quaternary evaporites and hydrological changes, Lake Tyrrell, North-West Victoria},
  journal = {Australian Journal of Earth Sciences},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{shuman2015hydrologicchangesincoloradoduringthemidholoceneandyoungerdryas,
  doi = {10.1016/j.yqres.2015.07.004},
  url = {https://doi.org/10.1016/j.yqres.2015.07.004},
  year = {2015},
  month = {sep},
  publisher = {Cambridge University Press ({CUP})},
  volume = {84},
  number = {2},
  pages = {187--199},
  author = {Bryan N. Shuman and Paul Pribyl and Jacob Buettner},
  title = {Hydrologic changes in Colorado during the mid-Holocene and Younger Dryas},
  journal = {Quaternary Research},
}

@Article{liefert2020pervasivedesiccationofnorthamericanlakesduringthelatequaternary,
  doi = {10.1029/2019gl086412},
  url = {https://doi.org/10.1029/2019gl086412},
  year = {2020},
  month = {feb},
  publisher = {American Geophysical Union ({AGU})},
  volume = {47},
  number = {3},
  author = {David T. Liefert and Bryan N. Shuman},
  title = {Pervasive Desiccation of North American Lakes During the Late Quaternary},
  journal = {Geophysical Research Letters},
}

@Article{kelts1986holocenesedimentologyofhypersalinelakeurmianorthwesterniran,
  doi = {10.1016/0031-0182(86)90120-3},
  url = {https://doi.org/10.1016/0031-0182(86)90120-3},
  year = {1986},
  month = {may},
  publisher = {Elsevier {BV}},
  volume = {54},
  number = {1-4},
  pages = {105--130},
  author = {Kerry Kelts and Mostafa Shahrabi},
  title = {Holocene sedimentology of hypersaline Lake Urmia, Northwestern Iran},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{bradbury1981latequaternaryenvironmentalhistoryoflakevalenciavenezuela,
  doi = {10.1126/science.214.4527.1299},
  url = {https://doi.org/10.1126/science.214.4527.1299},
  year = {1981},
  month = {dec},
  publisher = {American Association for the Advancement of Science ({AAAS})},
  volume = {214},
  number = {4527},
  pages = {1299--1305},
  author = {J. Platt Bradbury and B. Leyden and M. Salgado-Labouriau and W. M. Lewis and C. Schubert and M. W. Binford and D. G. Frey and D. R. Whitehead and F. H. Weibezahn},
  title = {Late Quaternary Environmental History of Lake Valencia, Venezuela},
  journal = {Science},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{fritz1973wabamunlakepastandpresentanisotopicstudyofthewaterbudgeiumonthelakesofwesterncanadaerreineltahlaycockandwmschultzedspp,
  year = {1973},
  author = {P. Fritz and H.R. Krouse},
  title = {Wabamun Lake past and present, an isotopic studyof the water budget},
  journal = {In : "Proceedings of theSymposium on the Lakes of Western Canada." (E.R.Reinelt, A.H. Laycock and W.M. Schultz, Eds.),pp.},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{long1981arizonaradiocarbondatesx,
  doi = {10.1017/s0033822200037590},
  url = {https://doi.org/10.1017/s0033822200037590},
  year = {1981},
  publisher = {Cambridge University Press ({CUP})},
  volume = {23},
  number = {2},
  pages = {191--217},
  author = {Austin Long and A B Muller},
  title = {Arizona Radiocarbon Dates X},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{long1981arizonaradiocarbondatesxradiocarbon23191217,
  doi = {10.1017/s0033822200037590},
  url = {https://doi.org/10.1017/s0033822200037590},
  year = {1981},
  publisher = {Cambridge University Press ({CUP})},
  volume = {23},
  number = {2},
  pages = {191--217},
  author = {Austin Long and A B Muller},
  title = {Arizona Radiocarbon Dates X},
  journal = {Radiocarbon},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{garrettjones1979holocenevegetationandlakesedimentationinthemarkhamvalleypngphdthesisaustraliannationaluniversitycanberra,
  year = {1979},
  author = {S. Garrett-Jones},
  title = {Holocene Vegetation and Lake Sedimentation in the Markham Valley, PNG. Ph.D. thesis, AustralianNational University, Canberra.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{steventon1984universityofwisconsinradiocarbondatesxxi,
  doi = {10.1017/s0033822200006494},
  url = {https://doi.org/10.1017/s0033822200006494},
  year = {1984},
  publisher = {Cambridge University Press ({CUP})},
  volume = {26},
  number = {1},
  pages = {135--147},
  author = {Raymond L Steventon and John E Kutzbach},
  title = {University of Wisconsin Radiocarbon Dates XXI},
  journal = {Radiocarbon},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{winkler1985lateglacialandholoceneenvironmentalhistoryofsouthcentlandecosystemsphdthesisuniversityofwisconsinmadisonmadison261pp,
  year = {1985},
  author = {M.G. Winkler},
  title = {Late-Glacial and Holocene Environmental History of South-Central Wisconsin : A Study of Upland and Wetland Ecosystems. Ph.D. thesis, University of Wisconsin-Madison, Madison, 261pp.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{fries1962pollenprofilesoflatepleistoceneandrecentsedimentsfromweberlakenortheasternminnesota,
  doi = {10.2307/1931985},
  url = {https://doi.org/10.2307/1931985},
  year = {1962},
  month = {apr},
  publisher = {Wiley},
  volume = {43},
  number = {2},
  pages = {295},
  author = {Magnus Fries},
  title = {Pollen Profiles of Late Pleistocene and Recent Sediments from Weber Lake, Northeastern Minnesota},
  journal = {Ecology},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{fries1962pollenprofilesoflatepleistoceneandrecentsedimentsatweberlakenortheasternminnesotaecology43295308,
  year = {1962},
  author = {M. Fries},
  title = {Pollen profiles of Late Pleistocene and recentsediments at Weber Lake, northeastern Minnesota.Ecology 43 : 295-308.},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{macdonald1982latequaternarypaleoenvironmentsofthemorleyflatsandkananaskisvalleyofsouthwesternalberta,
  doi = {10.1139/e82-003},
  url = {https://doi.org/10.1139/e82-003},
  year = {1982},
  month = {jan},
  publisher = {Canadian Science Publishing},
  volume = {19},
  number = {1},
  pages = {23--35},
  author = {Glen M. MacDonald},
  title = {Late Quaternary paleoenvironments of the Morley Flats and Kananaskis Valley of southwestern Alberta},
  journal = {Canadian Journal of Earth Sciences},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{macdonald1982latequaternarypalaeoenvironmentsofthemorleyflatsandkisvalleyofsouthwestalbertacanadianjournalofearthsciences192335,
  doi = {10.1139/e82-003},
  url = {https://doi.org/10.1139/e82-003},
  year = {1982},
  month = {jan},
  publisher = {Canadian Science Publishing},
  volume = {19},
  number = {1},
  pages = {23--35},
  author = {Glen M. MacDonald},
  title = {Late Quaternary paleoenvironments of the Morley Flats and Kananaskis Valley of southwestern Alberta},
  journal = {Canadian Journal of Earth Sciences},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{schmieder2011aregionalscaleclimatereconstructionofthelast4000yearsfromlakesinthenebraskasandhillsusa,
  doi = {10.1016/j.quascirev.2011.04.011},
  url = {https://doi.org/10.1016/j.quascirev.2011.04.011},
  year = {2011},
  month = {jun},
  publisher = {Elsevier {BV}},
  volume = {30},
  number = {13-14},
  pages = {1797--1812},
  author = {J. Schmieder and S.C. Fritz and J.B. Swinehart and A.L.C. Shinneman and A.P. Wolfe and G. Miller and N. Daniels and K.C. Jacobs and E.C. Grimm},
  title = {A regional-scale climate reconstruction of the last 4000 years from lakes in the Nebraska Sand Hills, USA},
  journal = {Quaternary Science Reviews},
}

@Article{schmieder2012holocenevariabilityinhydrologyvegetationfireandeolianactivityinthenebraskasandhillsusa,
  doi = {10.1177/0959683612463100},
  url = {https://doi.org/10.1177/0959683612463100},
  year = {2012},
  month = {dec},
  publisher = {{SAGE} Publications},
  volume = {23},
  number = {4},
  pages = {515--527},
  author = {Jens Schmieder and Sherilyn C Fritz and Eric C Grimm and Kimberly C Jacobs and Kendrick J Brown and James B Swinehart and Stephen C Porter},
  title = {Holocene variability in hydrology, vegetation, fire, and eolian activity in the Nebraska Sand Hills, USA},
  journal = {The Holocene},
}

@Article{watts1980latequaternaryvegetationhistoryatwhitepondontheinnercoastalplainofsouthcarolina,
  doi = {10.1016/0033-5894(80)90028-9},
  url = {https://doi.org/10.1016/0033-5894(80)90028-9},
  year = {1980},
  month = {mar},
  publisher = {Cambridge University Press ({CUP})},
  volume = {13},
  number = {2},
  pages = {187--199},
  author = {W. A. Watts},
  title = {Late-Quaternary Vegetation History at White Pond on the Inner Coastal Plain of South Carolina},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Book{manny1977paleolimnologicalsedimentationoforganiccarbonnitrogenphatomsinahypereutrophichardwaterlakeacasehistoryofeutrophication,
  doi = {10.2172/7300362},
  url = {http://dx.doi.org/10.2172/7300362},
  year = {1977},
  month = {jan},
  author = {B.A. Manny and R.G. Wetzel and R.E. Bailey},
  title = {Paleolimnological sedimentation of organic carbon, nitrogen, phosphorus, fossil pigments, pollen, and diatoms in a hypereutrophic, hardwater lake: a case history of eutrophication},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{manny1978paleolimnologicalsedimentationoforganiccarbonnitrogenphahypereutrophichardwaterlakeacasehistoryofeutrophicationpolskie,
  year = {1978},
  author = {B.A Manny and R.G. Wetzel and R.E. Bailey},
  title = {Paleolimnological sedimentation of organic carbon, nitrogen, phosphorus, fossil pigments, pollen, and diatoms in a hypereutrophic hardwater lake : Acase history of eutrophication. Polskie},
  journal = {unknown},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{hutchinson1963chemicalexaminationofacorefromlakezeribariran,
  doi = {10.1126/science.140.3562.67},
  url = {https://doi.org/10.1126/science.140.3562.67},
  year = {1963},
  month = {apr},
  publisher = {American Association for the Advancement of Science ({AAAS})},
  volume = {140},
  number = {3562},
  pages = {67--69},
  author = {G. E. Hutchinson and U. M. Cowgill},
  title = {Chemical Examination of a Core from Lake Zeribar, Iran},
  journal = {Science},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{fubao1987climaticchangesintheqinghaixizangtibetanregionofchinaduringtheholocene,
  doi = {10.1016/0033-5894(87)90032-9},
  url = {https://doi.org/10.1016/0033-5894(87)90032-9},
  year = {1987},
  month = {jul},
  publisher = {Cambridge University Press ({CUP})},
  volume = {28},
  number = {1},
  pages = {50--60},
  author = {Wang Fu-Bao and C. Y. Fan},
  title = {Climatic Changes in the Qinghai-Xizang (Tibetan) Region of China during the Holocene},
  journal = {Quaternary Research},
}

@Book{streetperrott1989globallakelevelvariationsfrom18000to0yearsagoapalaeoclimateanalysis,
  doi = {10.2172/5609291},
  url = {http://dx.doi.org/10.2172/5609291},
  year = {1989},
  month = {sep},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: A palaeoclimate analysis},
}

@Article{streetperrott1989oxfordlakestatus,
  doi = {10.2172/5609291},
  year = {1989},
  publisher = {Office of Scientific and Technical Information ({OSTI})},
  author = {F. Street-Perrott and D. Marchand and N. Roberts and S. Harrison},
  title = {Global lake-level variations from 18,000 to 0 years ago: {A} palaeoclimate analysis},
  journal = {{Oxford Univ.(UK). Geography School}},
}

@Article{sevastyanov1992missingtitle,
  year = {1992},
  author = {{Sevastyanov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{zhang1995missingtitle,
  year = {1995},
  author = {{Zhang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{cui1993missingtitle,
  year = {1993},
  author = {{Cui}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{han1991missingtitle,
  year = {1991},
  author = {{Han}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{han1990missingtitle,
  year = {1990},
  author = {{Han}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{han1993missingtitle,
  year = {1993},
  author = {{Han}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{li1991missingtitle,
  year = {1991},
  author = {{Li}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{juang1991missingtitle,
  year = {1991},
  author = {{Juang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{kucaite1967missingtitle,
  year = {1967},
  author = {{Kucaite}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{shuliya1967missingtitle,
  year = {1967},
  author = {{Shuliya}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{li1992missingtitle,
  year = {1992},
  author = {{Li}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{huang1996missingtitle,
  year = {1996},
  author = {{Huang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{bolikhovskaya1988missingtitle,
  year = {1988},
  author = {{Bolikhovskaya}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{davydova1978missingtitle,
  year = {1978},
  author = {{Davydova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{khomutova1994missingtitle,
  year = {1994},
  author = {{Khomutova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{khomutova1978missingtitle,
  year = {1978},
  author = {{Khomutova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{khotinskii1977missingtitle,
  year = {1977},
  author = {{Khotinskii}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{davydova1993missingtitle,
  year = {1993},
  author = {{Davydova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{korde1951missingtitle,
  year = {1951},
  author = {{Korde}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{sevastyanov1992missingtitle,
  year = {1992},
  author = {{Sevastyanov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{tamosaitis1993missingtitle,
  year = {1993},
  author = {{Tamosaitis}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{kabailiene1992missingtitle,
  year = {1992},
  author = {{Kabailiene}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{grigelyte1977missingtitle,
  year = {1977},
  author = {{Grigelyte}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{andreev1989missingtitle,
  year = {1989},
  author = {{Andreev}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{andreev1996missingtitle,
  year = {1996},
  author = {{Andreev}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{pestryakova1994missingtitle,
  year = {1994},
  author = {{Pestryakova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{huang1980missingtitle,
  year = {1980},
  author = {{Huang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{huang1990missingtitle,
  year = {1990},
  author = {{Huang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{du1983missingtitle,
  year = {1983},
  author = {{Du}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{chen1990missingtitle,
  year = {1990},
  author = {{Chen}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{xu1993missingtitle,
  year = {1993},
  author = {{Xu}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{huang1990missingtitle,
  year = {1990},
  author = {{Huang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{li1990missingtitle,
  year = {1990},
  author = {{Li}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{wang1989missingtitle,
  year = {1989},
  author = {{Wang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{zhang1990missingtitle,
  year = {1990},
  author = {{Zhang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{pulsiruyushchee1982missingtitle,
  year = {1982},
  author = {{Pul'siruyushchee}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{volkov1978missingtitle,
  year = {1978},
  author = {{Volkov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{khotinskii1977missingtitle,
  year = {1977},
  author = {{Khotinskii}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tyuremnov1956missingtitle,
  year = {1956},
  author = {{Tyuremnov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{huang1980missingtitle,
  year = {1980},
  author = {{Huang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{peglar1984missingtitle,
  year = {1984},
  author = {{Peglar}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{peglar1989missingtitle,
  year = {1989},
  author = {{Peglar}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{brook2007timingoflakelevelchangesinetoshapannamibiasincethemiddleholocenefromoslagesofrelictshorelinesintheokondekaregion,
  doi = {10.1016/j.quaint.2007.05.020},
  url = {http://dx.doi.org/10.1016/j.quaint.2007.05.020},
  year = {2007},
  month = {dec},
  publisher = {Elsevier BV},
  volume = {175},
  number = {1},
  pages = {29–40},
  author = {George A. Brook and Eugene Marais and Pradeep Srivastava and Thomas Jordan},
  title = {Timing of lake-level changes in Etosha Pan, Namibia, since the middle Holocene from OSL ages of relict shorelines in the Okondeka region},
  journal = {Quaternary International},
}

@Article{brook2011reassessmentofcarbonateagesbydatingbothcarbonateandorgashapannamibiastromatoliteevidenceofhumidphasesduringthelast20ka,
  doi = {10.1016/j.quaint.2010.05.009},
  url = {http://dx.doi.org/10.1016/j.quaint.2010.05.009},
  year = {2011},
  month = {jan},
  publisher = {Elsevier BV},
  volume = {229},
  number = {1–2},
  pages = {24–37},
  author = {George A. Brook and L. Bruce Railsback and Eugene Marais},
  title = {Reassessment of carbonate ages by dating both carbonate and organic material from an Etosha Pan (Namibia) stromatolite: Evidence of humid phases during the last 20ka},
  journal = {Quaternary International},
}

@Article{hipondoka2014chronologyofsandridgesandthelatequaternaryevolutionoftheetoshapannamibia,
  doi = {10.1016/j.geomorph.2013.08.034},
  url = {http://dx.doi.org/10.1016/j.geomorph.2013.08.034},
  year = {2014},
  month = {jan},
  publisher = {Elsevier BV},
  volume = {204},
  pages = {553–563},
  author = {M.H.T. Hipondoka and B. Mauz and J. Kempf and S. Packman and R.C. Chiverrell and J. Bloemendal},
  title = {Chronology of sand ridges and the Late Quaternary evolution of the Etosha Pan, Namibia},
  journal = {Geomorphology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{yakushko1992missingtitle,
  year = {1992},
  author = {{Yakushko}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{li1995missingtitle,
  year = {1995},
  author = {{Li}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{li1996missingtitle,
  year = {1996},
  author = {{Li}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{shan1996missingtitle,
  year = {1996},
  author = {{Shan}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{godwin1951missingtitle,
  year = {1951},
  author = {{Godwin}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{sims1978.missingtitle,
  year = {1978.},
  author = {{Sims}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{sevastyanov1992missingtitle,
  year = {1992},
  author = {{Sevastyanov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{khotinskii1977missingtitle,
  year = {1977},
  author = {{Khotinskii}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{khotinskii1991missingtitle,
  year = {1991},
  author = {{Khotinskii}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{bottema1974missingtitle,
  year = {1974},
  author = {{Bottema}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{higgs1966missingtitle,
  year = {1966},
  author = {{Higgs}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{higgs1967missingtitle,
  year = {1967},
  author = {{Higgs}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{fels1957missingtitle,
  year = {1957},
  author = {{Fels}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{geng1990missingtitle,
  year = {1990},
  author = {{Geng}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{anisimova1951missingtitle,
  year = {1951},
  author = {{Anisimova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{korde1951missingtitle,
  year = {1951},
  author = {{Korde}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1993missingtitle,
  year = {1993},
  author = {{Tarasov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{saarse1994missingtitle,
  year = {1994},
  author = {{Saarse}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{saarse1111missingtitle,
  year = {1111},
  author = {{Saarse}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{vipper1993missingtitle,
  year = {1993},
  author = {{Vipper}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{korde1968missingtitle,
  year = {1968},
  author = {{Korde}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{kokarovtsev1992missingtitle,
  year = {1992},
  author = {{Kokarovtsev}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{elina1988missingtitle,
  year = {1988},
  author = {{Elina}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{khomutova1978missingtitle,
  year = {1978},
  author = {{Khomutova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{khotinskii1977missingtitle,
  year = {1977},
  author = {{Khotinskii}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{shnitnikov1957missingtitle,
  year = {1957},
  author = {{Shnitnikov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{veselova1978missingtitle,
  year = {1978},
  author = {{Veselova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{gasse1977evolutionoflakeabhethiopiaandtfaifrom70000bp,
  doi = {10.1038/265042a0},
  url = {http://dx.doi.org/10.1038/265042a0},
  year = {1977},
  month = {jan},
  publisher = {Springer Science and Business Media LLC},
  volume = {265},
  number = {5589},
  pages = {42–45},
  author = {F. GASSE},
  title = {Evolution of Lake Abhé (Ethiopia and TFAI), from 70,000 b.p.},
  journal = {Nature},
}

@Article{gasse1978latequaternarylakelevelfluctuationsandenvironmentsofthenorthernriftvalleyandafarregionethiopiaanddjibouti,
  doi = {10.1016/0031-0182(78)90011-1},
  url = {http://dx.doi.org/10.1016/0031-0182(78)90011-1},
  year = {1978},
  month = {jul},
  publisher = {Elsevier BV},
  volume = {24},
  number = {4},
  pages = {279–325},
  author = {E. Gasse and F.A. Street},
  title = {Late Quaternary Lake-level fluctuations and environments of the northern Rift valley and Afar region (Ethiopia and Djibouti)},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{gasse1978latequaternarylakelevelfluctuationsandenvironmentsofthenorthernriftvalleyandafarregionethiopiaanddjibouti,
  doi = {10.1016/0031-0182(78)90011-1},
  url = {http://dx.doi.org/10.1016/0031-0182(78)90011-1},
  year = {1978},
  month = {jul},
  publisher = {Elsevier BV},
  volume = {24},
  number = {4},
  pages = {279–325},
  author = {E. Gasse and F.A. Street},
  title = {Late Quaternary Lake-level fluctuations and environments of the northern Rift valley and Afar region (Ethiopia and Djibouti)},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{gillespie1983postglacialaridepisodesinethiopiahaveimplicationsforclimateprediction,
  doi = {10.1038/306680a0},
  url = {https://doi.org/10.1038/306680a0},
  year = {1983},
  month = {dec},
  publisher = {Springer Science and Business Media {LLC}},
  volume = {306},
  number = {5944},
  pages = {680--683},
  author = {Richard Gillespie and F. Alayne Street-Perrott and Roy Switsur},
  title = {Post-glacial arid episodes in Ethiopia have implications for climate prediction},
  journal = {Nature},
}

@Article{chali2002lateglacialholocenediatomrecordofwaterchemistryandlakelevelchangefromthetropicaleastafricanriftlakeabiyataethiopia,
  doi = {10.1016/s0031-0182(02)00480-7},
  url = {http://dx.doi.org/10.1016/S0031-0182(02)00480-7},
  year = {2002},
  month = {nov},
  publisher = {Elsevier BV},
  volume = {187},
  number = {3–4},
  pages = {259–283},
  author = {Fran{\c c}oise Chali{\a'e} and Fran{\c c}oise Gasse},
  title = {Late Glacial–Holocene diatom record of water chemistry and lake level change from the tropical East African Rift Lake Abiyata (Ethiopia)},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{legesse2002environmentalchangesinatropicallakelakeabiyataethiopiaduringrecentcenturies,
  doi = {10.1016/s0031-0182(02)00479-0},
  url = {http://dx.doi.org/10.1016/S0031-0182(02)00479-0},
  year = {2002},
  month = {nov},
  publisher = {Elsevier BV},
  volume = {187},
  number = {3–4},
  pages = {233–258},
  author = {Dagnachew Legesse and F Gasse and O Radakovitch and C Vallet-Coulomb and R Bonnefille and D Verschuren and E Gibert and P Barker},
  title = {Environmental changes in a tropical lake (Lake Abiyata, Ethiopia) during recent centuries},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{marshall2009climaticchangeinnorthernethiopiaduringthepast17000yearsadiatomandstableisotoperecordfromlakeashenge,
  doi = {10.1016/j.palaeo.2009.05.003},
  url = {https://doi.org/10.1016/j.palaeo.2009.05.003},
  year = {2009},
  month = {aug},
  publisher = {Elsevier {BV}},
  volume = {279},
  number = {1-2},
  pages = {114--127},
  author = {Michael H. Marshall and Henry F. Lamb and Sarah J. Davies and Melanie J. Leng and Zelalem Kubsa and Mohammed Umer and Charlotte Bryant},
  title = {Climatic change in northern Ethiopia during the past 17,000~years: A diatom and stable isotope record from Lake Ashenge},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{eds1987ledemigrabendebaringobogoriariftgregorykenya30000ansdhistoirehydrologiqueetsedimentaire,
  year = {1987},
  author = {J.J {list Vincens A.}},
  title = {Le demi–graben de Baringo–Bogoria, Rift Gregory, Kenya: 30,000 ans d’histoire hydrologique et sedimentaire},
  journal = {unknown},
}

@Article{rb2000lakebaringokenyariftvalleyanditspleistoceneprecursors,
  year = {2000},
  author = {R.W {list Owen R.B.}},
  title = {Lake Baringo, Kenya Rift Valley, and its Pleistocene Precursors},
  journal = {unknown},
}

@Article{bessems2008palaeolimnologicalevidenceforwidespreadlate18thcenturydroughtacrossequatorialeastafrica,
  doi = {10.1016/j.palaeo.2007.10.002},
  url = {http://dx.doi.org/10.1016/j.palaeo.2007.10.002},
  year = {2008},
  month = {mar},
  publisher = {Elsevier BV},
  volume = {259},
  number = {2–3},
  pages = {107–120},
  author = {Ilse Bessems and Dirk Verschuren and James M. Russell and Jozef Hus and Florias Mees and Brian F. Cumming},
  title = {Palaeolimnological evidence for widespread late 18th century drought across equatorial East Africa},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{kiage2009palynologicalevidenceofclimatechangeandlanddegradationinthelakebaringoareakenyaeastafricasincead1650,
  doi = {10.1016/j.palaeo.2009.05.001},
  url = {http://dx.doi.org/10.1016/j.palaeo.2009.05.001},
  year = {2009},
  month = {aug},
  publisher = {Elsevier BV},
  volume = {279},
  number = {1–2},
  pages = {60–72},
  author = {Lawrence M. Kiage and Kam-biu Liu},
  title = {Palynological evidence of climate change and land degradation in the Lake Baringo area, Kenya, East Africa, since AD 1650},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{kiage2009paleoenvironmentalchangesinthelakebaringobasinkenyaeastafricasincead1650evidencefromthepaleorecord,
  doi = {10.1080/00330120903143425},
  url = {http://dx.doi.org/10.1080/00330120903143425},
  year = {2009},
  month = {oct},
  publisher = {Informa UK Limited},
  volume = {61},
  number = {4},
  pages = {438–458},
  author = {Lawrence M. Kiage and Kam-biu Liu},
  title = {Paleoenvironmental Changes in the Lake Baringo Basin, Kenya, East Africa Since AD 1650: Evidence from the Paleorecord∗},
  journal = {The Professional Geographer},
}

@InBook{obando2016impactofshorttermfloodingonlivelihoodsinthekenyariftvalleylakes,
  doi = {10.1007/978-4-431-56000-5_12},
  url = {http://dx.doi.org/10.1007/978-4-431-56000-5_12},
  year = {2016},
  publisher = {Springer Japan},
  pages = {193–215},
  author = {Joy A. Obando and Simon Onywere and Chris Shisanya and Anthony Ndubi and Dan Masiga and Zephania Irura and Nicholas Mariita and Haron Maragia},
  title = {Impact of Short-Term Flooding on Livelihoods in the Kenya Rift Valley Lakes},
  booktitle = {Geomorphology and Society},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{dedeckker1982holoceneostracodesotherinvertebratesandfishremainsfromcoresoffourmaarlakesinsoutheasternaustralia,
  year = {1982},
  author = {P. {De Deckker}},
  title = {Holocene ostracodes, other invertebrates and fish remains from cores of four maar lakes in Southeastern Australia},
  journal = {Proceedings of the Royal Society of Victoria},
}

@Article{dodson1979latepleistocenevegetationandenvironmentsnearlakebullenmerriwesternvictoria,
  doi = {10.1111/j.1442-9993.1979.tb01570.x},
  url = {https://doi.org/10.1111/j.1442-9993.1979.tb01570.x},
  year = {1979},
  month = {dec},
  publisher = {Wiley},
  volume = {4},
  number = {4},
  pages = {419--427},
  author = {J. R. Dodson},
  title = {Late Pleistocene vegetation and environments near Lake Bullenmerri, Western Victoria},
  journal = {Austral Ecology},
}

@Article{barton1981a10000yrgeomagneticsecularvariationrecordfromthreeaustralianmaars,
  year = {1981},
  author = {C.E Barton},
  title = {A 10000 yr geomagnetic secular variation record from three Australian maars},
  journal = {Geophysical Journal International},
}

@Article{barton1982timeseriesanalysisofthe10000yrgeomagneticsecularvariationrecordfromseaustralia,
  year = {1982},
  author = {C.E Barton},
  title = {Time series analysis of the 10 000 yr geomagnetic secular variation record from SE Australia},
  journal = {Geophysical Journal International},
}

@Article{barton1981magneticstratigraphysedimentologyand14cagesofthreeaustralianmaars,
  year = {1981},
  author = {C.E Barton},
  title = {Magnetic stratigraphy, sedimentology and 14C ages of three Australian maars},
  journal = {unpublished},
}

@Article{jones1995modellinghydrologicandclimaticcontrolsofclosedlakeswesternvictoria,
  year = {1995},
  author = {R.N. Jones},
  title = {Modelling hydrologic and climatic controls of closed lakes western Victoria},
  journal = {Ph.D. Thesis. University of Melbourne, Melbourne},
}

@Article{jones1998ahighresolutionholocenerecordofperatiofromclosedlakeswesternvictoria,
  year = {1998},
  author = {R.N Jones},
  title = {A high resolution Holocene record of P/E ratio from closed lakes, western Victoria},
  journal = {Palaeoclimates},
}

@Article{clerke2023hydrologicalregimeofaustralianlakesoverthelatequaternaryandholocene,
  doi = {10.25949/22662253.v1},
  year = {2023},
  author = {L. Clerke},
  title = {Hydrological regime of Australian lakes over the Late-Quaternary and Holocene},
  journal = {PhD Thesis},
}

@Article{payne1970waterbalanceoflakechalaanditsrelationtogroundwaterfromtritiumandstableisotopedata,
  doi = {10.1016/0022-1694(70)90114-9},
  url = {http://dx.doi.org/10.1016/0022-1694(70)90114-9},
  year = {1970},
  month = {jul},
  publisher = {Elsevier BV},
  volume = {11},
  number = {1},
  pages = {47–58},
  author = {Bryan R. Payne},
  title = {Water balance of Lake Chala and its relation to groundwater from tritium and stable isotope data},
  journal = {Journal of Hydrology},
}

@Article{verschuren2009halfprecessionaldynamicsofmonsoonrainfallneartheeastafricanequator,
  doi = {10.1038/nature08520},
  url = {http://dx.doi.org/10.1038/nature08520},
  year = {2009},
  month = {dec},
  publisher = {Springer Science and Business Media LLC},
  volume = {462},
  number = {7273},
  pages = {637–641},
  author = {Dirk Verschuren and Jaap S. {Sinninghe Damst{\a'e}} and Jasper Moernaut and Iris Kristen and Maarten Blaauw and Maureen Fagot and Gerald H. Haug},
  title = {Half-precessional dynamics of monsoon rainfall near the East African Equator},
  journal = {Nature},
}

@Article{moernaut2010theseismicstratigraphicrecordoflakelevelfluctuationsogicalstabilityandchangeinequatorialeastafricaoverthelast140kyr,
  doi = {10.1016/j.epsl.2009.12.023},
  url = {http://dx.doi.org/10.1016/j.epsl.2009.12.023},
  year = {2010},
  month = {feb},
  publisher = {Elsevier BV},
  volume = {290},
  number = {1–2},
  pages = {214–223},
  author = {J. Moernaut and D. Verschuren and F. Charlet and I. Kristen and M. Fagot and M. {De Batist}},
  title = {The seismic-stratigraphic record of lake-level fluctuations in Lake Challa: Hydrological stability and change in equatorial East Africa over the last 140 kyr},
  journal = {Earth and Planetary Science Letters},
}

@Article{wolff2011reducedinterannualrainfallvariabilityineastafricaduringthelasticeage,
  doi = {10.1126/science.1203724},
  url = {http://dx.doi.org/10.1126/science.1203724},
  year = {2011},
  month = {aug},
  publisher = {American Association for the Advancement of Science (AAAS)},
  volume = {333},
  number = {6043},
  pages = {743–747},
  author = {Christian Wolff and Gerald H. Haug and Axel Timmermann and Jaap S. Sinninghe Damst{\a'e} and Achim Brauer and Daniel M. Sigman and Mark A. Cane and Dirk Verschuren},
  title = {Reduced Interannual Rainfall Variability in East Africa During the Last Ice Age},
  journal = {Science},
}

@Article{blaauw2011highresolution14cdatingofa25000yearlakesedimentrecordfromequatorialeastafrica,
  doi = {10.1016/j.quascirev.2011.07.014},
  url = {https://doi.org/10.1016/j.quascirev.2011.07.014},
  year = {2011},
  month = {oct},
  publisher = {Elsevier {BV}},
  volume = {30},
  number = {21-22},
  pages = {3043--3059},
  author = {Maarten Blaauw and Bas {van Geel} and Iris Kristen and Birgit Plessen and Anna Lyaruu and Daniel R. Engstrom and Johannes {van der Plicht} and Dirk Verschuren},
  title = {High-resolution 14C dating of a 25,000-year lake-sediment record from equatorial East Africa},
  journal = {Quaternary Science Reviews},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{kershaw1970apollendiagramfromlakeeuramoonortheastqueenslandaustralia,
  doi = {10.1111/j.1469-8137.1970.tb02463.x},
  url = {https://doi.org/10.1111/j.1469-8137.1970.tb02463.x},
  year = {1970},
  month = {jul},
  publisher = {Wiley},
  volume = {69},
  number = {3},
  pages = {785--805},
  author = {A. P. Kershaw},
  title = {A pollen diagram from Lake Euramoo, North-east Queensland, Australia},
  journal = {New Phytologist},
}

@Article{haberle2005a23000yrpollenrecordfromlakeeuramoowettropicsofnequeenslandaustralia,
  year = {2005},
  author = {S.G. Haberle},
  title = {A 23,000-yr pollen record from Lake Euramoo, Wet Tropics of NE Queensland, Australia},
  journal = {Quaternary Research},
}

@Article{tibby2007alateglacialtopresentdiatomrecordfromlakeeuramoowettropicsofqueenslandaustralia,
  doi = {10.1016/j.palaeo.2007.02.017},
  url = {http://dx.doi.org/10.1016/j.palaeo.2007.02.017},
  year = {2007},
  month = {jul},
  publisher = {Elsevier BV},
  volume = {251},
  number = {1},
  pages = {46–56},
  author = {J. Tibby and S.G. Haberle},
  title = {A late glacial to present diatom record from Lake Euramoo, wet tropics of Queensland, Australia},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{clerke2023hydrologicalregimeofaustralianlakesoverthelatequaternaryandholocene,
  doi = {10.25949/22662253.v1},
  year = {2023},
  author = {L. Clerke},
  title = {Hydrological regime of Australian lakes over the Late-Quaternary and Holocene},
  journal = {PhD Thesis},
}

@Article{wilkins2012comparativeopticalandradiocarbondatingoflaminatedholoarlakeslakekeilambeteandlakegnotuksouthwesternvictoriaaustralia,
  year = {2012},
  author = {D Wilkins},
  title = {Comparative optical and radiocarbon dating of laminated Holocene sediments in two maar lakes: Lake Keilambete and Lake Gnotuk, south-western Victoria, Australia},
  journal = {Quaternary Geochronology},
}

@Article{dedeckker1982holoceneostracodesotherinvertebratesandfishremainsfromcoresoffourmaarlakesinsoutheasternaustralia,
  year = {1982},
  author = {P. {De Deckker}},
  title = {Holocene ostracodes, other invertebrates and fish remains from cores of four maar lakes in Southeastern Australia},
  journal = {Proceedings of the Royal Society of Victoria},
}

@Article{clerke2023hydrologicalregimeofaustralianlakesoverthelatequaternaryandholocene,
  doi = {10.25949/22662253.v1},
  year = {2023},
  author = {L. Clerke},
  title = {Hydrological regime of Australian lakes over the Late-Quaternary and Holocene},
  journal = {PhD Thesis},
}

@Article{wilkins2012comparativeopticalandradiocarbondatingoflaminatedholoarlakeslakekeilambeteandlakegnotuksouthwesternvictoriaaustralia,
  year = {2012},
  author = {D Wilkins},
  title = {Comparative optical and radiocarbon dating of laminated Holocene sediments in two maar lakes: Lake Keilambete and Lake Gnotuk, south-western Victoria, Australia},
  journal = {Quaternary Geochronology},
}

@Article{dedeckker1982holoceneostracodesotherinvertebratesandfishremainsfromcoresoffourmaarlakesinsoutheasternaustralia,
  year = {1982},
  author = {P. {De Deckker}},
  title = {Holocene ostracodes, other invertebrates and fish remains from cores of four maar lakes in Southeastern Australia},
  journal = {Proceedings of the Royal Society of Victoria},
}

@Article{clerke2023hydrologicalregimeofaustralianlakesoverthelatequaternaryandholocene,
  doi = {10.25949/22662253.v1},
  year = {2023},
  author = {L. Clerke},
  title = {Hydrological regime of Australian lakes over the Late-Quaternary and Holocene},
  journal = {PhD Thesis},
}

@Article{br1988lowlakestandsinlakemalawiandtanganyikaeastafricadelinatedwithmultifoldsesimicdata,
  year = {1988},
  author = {C.A {list Rosendahl B.R.}},
  title = {Low lake stands in Lake Malawi and Tanganyika East Africa, delinated with multifold sesimic data},
  journal = {unknown},
}

@Article{b1989architectureofthelakemalawirifteastafrica,
  year = {1989},
  author = {T {list Rosendahl B.}},
  title = {Architecture of the Lake Malawi Rift, East Africa},
  journal = {unknown},
}

@Article{de1990majorlowlevelsoflakemalawiandtheirimplicationsforspeciationratesincichlidfishes,
  doi = {10.1098/rspb.1990.0052},
  year = {1990},
  publisher = {The Royal Society},
  volume = {240},
  pages = {519–553},
  author = {R.B {list Engstrom D.E.}},
  title = {Major Low Levels of Lake Malawi and their Implications for Speciation Rates in Cichlid Fishes},
  journal = {Proceedings of the Royal Society of London. B. Biological Sciences},
}

@Article{finney1991sedimentationinlakemalawieastafricaduringthepast10000yearsacontinuouspaleoclimaticrecordfromthesoutherntropics,
  doi = {10.1016/0031-0182(91)90167-p},
  url = {http://dx.doi.org/10.1016/0031-0182(91)90167-P},
  year = {1991},
  month = {jun},
  publisher = {Elsevier BV},
  volume = {85},
  number = {3–4},
  pages = {351–366},
  author = {Bruce P. Finney and Thomas C. Johnson},
  title = {Sedimentation in Lake Malawi (East Africa) during the past 10,000 years: a continuous paleoclimatic record from the southern tropics},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{scholz1994latequaternarysequencestratigraphyoflakemalawinyasaafrica,
  doi = {10.1111/j.1365-3091.1994.tb01397.x},
  url = {http://dx.doi.org/10.1111/j.1365-3091.1994.tb01397.x},
  year = {1994},
  month = {feb},
  publisher = {Wiley},
  volume = {41},
  number = {1},
  pages = {163–179},
  author = {CHRISTOPHER A. SCHOLZ and BRUCE P. FINNEY},
  title = {Late Quaternary sequence stratigraphy of Lake Malawi (Nyasa), Africa},
  journal = {Sedimentology},
}

@Article{ricketts1996climatechangeintheturkanabasinasdeducedfroma4000yearlongo18record,
  doi = {10.1016/0012-821x(96)00094-5},
  url = {http://dx.doi.org/10.1016/0012-821X(96)00094-5},
  year = {1996},
  month = {jul},
  publisher = {Elsevier BV},
  volume = {142},
  number = {1–2},
  pages = {7–17},
  author = {R.D. Ricketts and T.C. Johnson},
  title = {Climate change in the Turkana basin as deduced from a 4000 year long δO18 record},
  journal = {Earth and Planetary Science Letters},
}

@Article{j1996combinedeffectsofdissolvedsolidsandtemperatureonthedensitystratificationoflakemalawi,
  year = {1996},
  author = {A {list Halfman J.}},
  title = {Combined effects of dissolved solids and temperature on the density stratification of Lake Malawi},
  journal = {unknown},
}

@Article{johnson2001decadalrecordofclimatevariabilityspanningthepast700yrinthesoutherntropicsofeastafrica,
  doi = {10.1130/0091-7613(2001)029<0083:drocvs>2.0.co;2},
  url = {http://dx.doi.org/10.1130/0091-7613(2001)029<0083:DROCVS>2.0.CO;2},
  year = {2001},
  publisher = {Geological Society of America},
  volume = {29},
  number = {1},
  pages = {83},
  author = {Thomas C. Johnson and Sylvia L. Barry and Yvonne Chan and Paul Wilkinson},
  title = {Decadal record of climate variability spanning the past 700 yr in the Southern Tropics of East Africa},
  journal = {Geology},
}

@Article{t2002sedimentologyandgeochronologyoflatepleistoceneandholocenesedimentsfromnorthernlakemalawi,
  year = {2002},
  author = {S {list Johnson T.}},
  title = {Sedimentology and geochronology of late Pleistocene and Holocene sediments from northern Lake Malawi},
  journal = {unknown},
}

@Article{t2002a24000yrdiatomrecordfromthenorthernbasinoflakemalawi,
  year = {2002},
  author = {F {list Johnson T.}},
  title = {A 24,000 yr diatom record from the northern basin of Lake Malawi},
  journal = {unknown},
}

@Article{filippi2005thepalaeolimnologyofnorthernlakemalawioverthelast25kaelementalandstableisotopiccompositionofsedimentaryorganicmatter,
  doi = {10.1016/j.quascirev.2004.10.009},
  url = {http://dx.doi.org/10.1016/j.quascirev.2004.10.009},
  year = {2005},
  month = {may},
  publisher = {Elsevier BV},
  volume = {24},
  number = {10–11},
  pages = {1303–1328},
  author = {M FILIPPI and M TALBOT},
  title = {The palaeolimnology of northern Lake Malawi over the last 25ka based upon the elemental and stable isotopic composition of sedimentary organic matter},
  journal = {Quaternary Science Reviews},
}

@Article{johnson2008transportmechanismandpaleoclimaticsignificanceofterrigenoussiltdepositedinvarvedsedimentsofanafricanriftlake,
  doi = {10.4319/lo.2008.53.4.1622},
  url = {http://dx.doi.org/10.4319/lo.2008.53.4.1622},
  year = {2008},
  month = {jul},
  publisher = {Wiley},
  volume = {53},
  number = {4},
  pages = {1622–1632},
  author = {Thomas C. Johnson and I. N. McCave},
  title = {Transport mechanism and paleoclimatic significance of terrigenous silt deposited in varved sediments of an African rift lake},
  journal = {Limnology and Oceanography},
}

@Article{scholz2011scientificdrillinginthegreatriftvalleythe2005lakemalawst145000yearsofclimatevariabilityinsouthernhemisphereeastafrica,
  doi = {10.1016/j.palaeo.2010.10.030},
  url = {http://dx.doi.org/10.1016/j.palaeo.2010.10.030},
  year = {2011},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {303},
  number = {1–4},
  pages = {3–19},
  author = {C.A. Scholz and A.S. Cohen and T.C. Johnson and J. King and M.R. Talbot and E.T. Brown},
  title = {Scientific drilling in the Great Rift Valley: The 2005 Lake Malawi Scientific Drilling Project — An overview of the past 145,000years of climate variability in Southern Hemisphere East Africa},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{vanbocxlaer2012stratigraphyandpaleoenvironmentsoftheearlytomiddleholocenechipalamawambabedsmalawibasinafrica,
  doi = {10.5194/bg-9-4497-2012},
  url = {http://dx.doi.org/10.5194/bg-9-4497-2012},
  year = {2012},
  month = {nov},
  publisher = {Copernicus GmbH},
  volume = {9},
  number = {11},
  pages = {4497–4512},
  author = {B. {Van Bocxlaer} and W. Salenbien and N. Praet and J. Verniers},
  title = {Stratigraphy and paleoenvironments of the early to middle Holocene Chipalamawamba Beds (Malawi Basin, Africa)},
  journal = {Biogeosciences},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{williamson1999magneticsignaturesofhydrologicalchangeinatropicalmaarlakelakemassokotanzaniapreliminaryresults,
  doi = {10.1016/s1464-1895(99)00117-9},
  url = {http://dx.doi.org/10.1016/S1464-1895(99)00117-9},
  year = {1999},
  month = {jan},
  publisher = {Elsevier BV},
  volume = {24},
  number = {9},
  pages = {799–803},
  author = {D. Williamson and M.J. Jackson and S.K. Banerjee and J. Marvin and O. Merdaci and N. Thouveny and M. Decobert and E. Gibert-Massault and M. Massault and D. Mazaudier and M. Taieb},
  title = {Magnetic signatures of hydrological change in a tropical maar-lake (Lake Massoko, Tanzania): Preliminary results},
  journal = {Physics and Chemistry of the Earth, Part A: Solid Earth and Geodesy},
}

@Article{barker2000thesensitivityofatanzaniancraterlaketocatastrophictephrainputandfourmillenniaofclimatechange,
  doi = {10.1191/095968300672848582},
  url = {http://dx.doi.org/10.1191/095968300672848582},
  year = {2000},
  month = {apr},
  publisher = {SAGE Publications},
  volume = {10},
  number = {3},
  pages = {303–310},
  author = {Philip Barker and Richard Telford and Ouassila Merdaci and David Williamson and Maurice Taieb and Annie Vincens and Elisabeth Gibert},
  title = {The sensitivity of a Tanzanian crater lake to catastrophic tephra input and                 four millennia of climate change},
  journal = {The Holocene},
}

@Article{gibert2002ams14cchronologyof400calkabpcontinuousdepositsfromacraterlakelakemassokotanzania,
  doi = {10.1016/s0031-0182(02)00483-2},
  url = {http://dx.doi.org/10.1016/S0031-0182(02)00483-2},
  year = {2002},
  month = {nov},
  publisher = {Elsevier BV},
  volume = {187},
  number = {3–4},
  pages = {307–322},
  author = {Elisabeth Gibert and Laurent Bergonzini and Marc Massault and David Williamson},
  title = {AMS-14C chronology of 40.0 cal ka BP continuous deposits from a crater lake (Lake Massoko, Tanzania)},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{barker2003newevidenceforareducedwaterbalanceineastafricaduringthelastglacialmaximumimplicationformodeldatacomparison,
  doi = {10.1016/s0277-3791(03)00010-6},
  url = {http://dx.doi.org/10.1016/S0277-3791(03)00010-6},
  year = {2003},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {22},
  number = {8–9},
  pages = {823–837},
  author = {Philip Barker and Fran{\c c}oise Gasse},
  title = {New evidence for a reduced water balance in East Africa during the Last Glacial Maximum: implication for model-data comparison},
  journal = {Quaternary Science Reviews},
}

@Article{barker2003climaticandvolcanicforcingrevealedina50000yeardiatomrecordfromlakemassokotanzania,
  doi = {10.1016/j.yqres.2003.07.001},
  url = {http://dx.doi.org/10.1016/j.yqres.2003.07.001},
  year = {2003},
  month = {jul},
  publisher = {Cambridge University Press (CUP)},
  volume = {60},
  number = {3},
  pages = {368–376},
  author = {Philip Barker and David Williamson and Fran{\c c}oise Gasse and Elisabeth Gibert},
  title = {Climatic and volcanic forcing revealed in a 50,000-year diatom record from Lake Massoko, Tanzania},
  journal = {Quaternary Research},
}

@Article{d2005contributiontothedetectionoflakemasokotanzaniagroundwateroutflowisotopicevidence18od,
  year = {2005},
  author = {M {list Williamson D.}},
  title = {Contribution to the detection of Lake Masoko (Tanzania) groundwater outflow: isotopic evidence (18O, D)},
  journal = {unknown},
}

@Article{garcin2006centennialtomillennialchangesinmaarlakedepositionduringthelast45000yearsintropicalsouthernafricalakemasokotanzania,
  doi = {10.1016/j.palaeo.2006.02.002},
  url = {http://dx.doi.org/10.1016/j.palaeo.2006.02.002},
  year = {2006},
  month = {sep},
  publisher = {Elsevier BV},
  volume = {239},
  number = {3–4},
  pages = {334–354},
  author = {Yannick Garcin and David Williamson and Maurice Taieb and Annie Vincens and Pierre-Etienne Math{\a'e} and Amos Majule},
  title = {Centennial to millennial changes in maar-lake deposition during the last 45,000 years in tropical Southern Africa (Lake Masoko, Tanzania)},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{garcin2006wetphasesintropicalsouthernafricaduringthelastglacialperiod,
  doi = {10.1029/2005gl025531},
  url = {http://dx.doi.org/10.1029/2005GL025531},
  year = {2006},
  month = {apr},
  publisher = {American Geophysical Union (AGU)},
  volume = {33},
  number = {7},
  author = {Yannick Garcin and Annie Vincens and David Williamson and Jo{\"e}l Guiot and Guillaume Buchet},
  title = {Wet phases in tropical southern Africa during the last glacial period},
  journal = {Geophysical Research Letters},
}

@Article{garcin2006solarandanthropogenicimprintsonlakemasokosoutherntanzaniaduringthelast500years,
  doi = {10.1007/s10933-006-9033-6},
  url = {http://dx.doi.org/10.1007/s10933-006-9033-6},
  year = {2006},
  month = {oct},
  publisher = {Springer Science and Business Media LLC},
  volume = {37},
  number = {4},
  pages = {475–490},
  author = {Yannick Garcin and David Williamson and Laurent Bergonzini and Olivier Radakovitch and Annie Vincens and Guillaume Buchet and Jo{\"e}l Guiot and Simon Brewer and Pierre-Etienne Math{\a'e} and Amos Majule},
  title = {Solar and anthropogenic imprints on Lake Masoko (southern Tanzania) during the last 500 years},
  journal = {Journal of Paleolimnology},
}

@Article{garcin2007abruptresumptionoftheafricanmonsoonattheyoungerdryasholoceneclimatictransition,
  doi = {10.1016/j.quascirev.2006.10.014},
  url = {http://dx.doi.org/10.1016/j.quascirev.2006.10.014},
  year = {2007},
  month = {mar},
  publisher = {Elsevier BV},
  volume = {26},
  number = {5–6},
  pages = {690–704},
  author = {Y GARCIN and A VINCENS and D WILLIAMSON and G BUCHET and J GUIOT},
  title = {Abrupt resumption of the African Monsoon at the Younger Dryas—Holocene climatic transition},
  journal = {Quaternary Science Reviews},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{washbournkamau1975latequaternaryshorelinesoflakenaivashakenya,
  doi = {10.1080/00672707509511614},
  url = {http://dx.doi.org/10.1080/00672707509511614},
  year = {1975},
  month = {jan},
  publisher = {Informa UK Limited},
  volume = {10},
  number = {1},
  pages = {77–92},
  author = {Celia K. Washbourn-Kamau},
  title = {Late Quaternary Shorelines of Lake Naivasha, Kenya},
  journal = {Azania: Archaeological Research in Africa},
}

@Article{richardson1986paleolimnologyofmidelevationlakesinthekenyariftvalley,
  doi = {10.1007/bf00026659},
  url = {http://dx.doi.org/10.1007/BF00026659},
  year = {1986},
  month = {dec},
  publisher = {Springer Science and Business Media LLC},
  volume = {143},
  number = {1},
  pages = {167–174},
  author = {J. L. Richardson and R. A. Dussinger},
  title = {Paleolimnology of mid-elevation lakes in the Kenya Rift Valley},
  journal = {Hydrobiologia},
}

@Article{verschuren2000rainfallanddroughtinequatorialeastafricaduringthepast1100years,
  doi = {10.1038/35000179},
  url = {http://dx.doi.org/10.1038/35000179},
  year = {2000},
  month = {jan},
  publisher = {Springer Science and Business Media LLC},
  volume = {403},
  number = {6768},
  pages = {410–414},
  author = {Dirk Verschuren and Kathleen R. Laird and Brian F. Cumming},
  title = {Rainfall and drought in equatorial east Africa during the past 1,100 years},
  journal = {Nature},
}

@Article{listverschuren2001reconstructingfluctuationsofashalloweastafricangthepast1800yrsfromsedimentstratigraphyinasubmergedcraterbasin,
  doi = {10.1023/A:1011150300252},
  year = {2001},
  publisher = {Springer Science and Business Media LLC},
  volume = {25},
  pages = {297–311},
  author = {Dirk") list("Verschuren},
  title = {Reconstructing fluctuations of a shallow East African lake during the past 1800 yrs from sediment stratigraphy in a submerged crater basin},
  journal = {Journal of Paleolimnology},
}

@Article{bergner2003paleoprecipitationestimatesforthelakenaivashabasinkenyaduringthelast175kyusingalakebalancemodel,
  doi = {10.1016/s0921-8181(02)00178-9},
  url = {http://dx.doi.org/10.1016/S0921-8181(02)00178-9},
  year = {2003},
  month = {mar},
  publisher = {Elsevier BV},
  volume = {36},
  number = {1–2},
  pages = {117–136},
  author = {A.G.N Bergner and M.H Trauth and B Bookhagen},
  title = {Paleoprecipitation estimates for the Lake Naivasha basin (Kenya) during the last 175 k.y. using a lake-balance model},
  journal = {Global and Planetary Change},
}

@Article{bergner2004comparisonofthehydrologicalandhydrochemicalevolutionoflakenaivashakenyaduringthreehighstandsbetween175and60kyrbp,
  doi = {10.1016/s0031-0182(04)00437-7},
  url = {http://dx.doi.org/10.1016/S0031-0182(04)00437-7},
  year = {2004},
  month = {dec},
  publisher = {Elsevier BV},
  volume = {215},
  number = {1–2},
  pages = {17–36},
  author = {A BERGNER and M TRAUTH},
  title = {Comparison of the hydrological and hydrochemical evolution of Lake Naivasha (Kenya) during three highstands between 175 and 60 kyr BP},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{vandermeeren2019ecohydrologicalevolutionoflakenaivashacentralrifearsasrecordedbyostracodassemblagesandstableisotopegeochemistry,
  doi = {10.1016/j.quascirev.2019.105906},
  url = {http://dx.doi.org/10.1016/j.quascirev.2019.105906},
  year = {2019},
  month = {nov},
  publisher = {Elsevier BV},
  volume = {223},
  pages = {105906},
  author = {Thijs {Van der Meeren} and Emi Ito and Kathleen R. Laird and Brian F. Cumming and Dirk Verschuren},
  title = {Ecohydrological evolution of Lake Naivasha (central Rift Valley, Kenya) during the past 1650 years, as recorded by ostracod assemblages and stable-isotope geochemistry},
  journal = {Quaternary Science Reviews},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{haberyan1987fossildiatomsandthepaleolimnologyoflakerukwatanzania,
  doi = {10.1111/j.1365-2427.1987.tb01064.x},
  url = {http://dx.doi.org/10.1111/j.1365-2427.1987.tb01064.x},
  year = {1987},
  month = {jun},
  publisher = {Wiley},
  volume = {17},
  number = {3},
  pages = {429–436},
  author = {KURT A. HABERYAN},
  title = {Fossil diatoms and the paleolimnology of Lake Rukwa, Tanzania},
  journal = {Freshwater Biology},
}

@Article{talbot1989hydrogenindexandcarbonisotopesoflacustrineorganicmatteraslakelevelindicators,
  doi = {10.1016/0031-0182(89)90084-9},
  url = {http://dx.doi.org/10.1016/0031-0182(89)90084-9},
  year = {1989},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {70},
  number = {1–3},
  pages = {121–137},
  author = {Michael R. Talbot and Daniel A. Livingstone},
  title = {Hydrogen index and carbon isotopes of lacustrine organic matter as lake level indicators},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{delvaux1998latequaternarytectonicactivityandlakelevelchangeintherukwariftbasin,
  doi = {10.1016/s0899-5362(98)00023-2},
  url = {http://dx.doi.org/10.1016/S0899-5362(98)00023-2},
  year = {1998},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {26},
  number = {3},
  pages = {397–421},
  author = {D. Delvaux and F. Kervyn and E. Vittori and R.S.A. Kajara and E. Kilembe},
  title = {Late Quaternary tectonic activity and lake level change in the Rukwa Rift Basin},
  journal = {Journal of African Earth Sciences},
}

@Article{listnicholson1999historicalandmodernfluctuationsoflakestanganyikaandrukwaandtheirrelationshiptorainfallvariability,
  doi = {10.1023/A:1005424619718},
  year = {1999},
  publisher = {Springer Science and Business Media LLC},
  volume = {41},
  pages = {53–71},
  author = {Sharon E.") list("Nicholson},
  title = {Historical and Modern Fluctuations of Lakes Tanganyika and Rukwa and Their Relationship to Rainfall Variability},
  journal = {Climatic Change},
}

@Article{thevenon2002a22kyrbpsedimentologicalrecordoflakerukwa8sswtanzaniaenvironmentalchronostratigraphicandclimaticimplications,
  doi = {10.1016/s0031-0182(02)00481-9},
  url = {http://dx.doi.org/10.1016/S0031-0182(02)00481-9},
  year = {2002},
  month = {nov},
  publisher = {Elsevier BV},
  volume = {187},
  number = {3–4},
  pages = {285–294},
  author = {F Thevenon and D Williamson and M Taieb},
  title = {A 22 kyr BP sedimentological record of Lake Rukwa (8°S, SW Tanzania): environmental, chronostratigraphic and climatic implications},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{barker2002latepleistoceneandholocenepalaeohydrologyoflakerukwatanzaniainferredfromdiatomanalysis,
  doi = {10.1016/s0031-0182(02)00482-0},
  url = {http://dx.doi.org/10.1016/S0031-0182(02)00482-0},
  year = {2002},
  month = {nov},
  publisher = {Elsevier BV},
  volume = {187},
  number = {3–4},
  pages = {295–305},
  author = {Philip Barker and Richard Telford and Fran{\c c}oise Gasse and Florian Thevenon},
  title = {Late Pleistocene and Holocene palaeohydrology of Lake Rukwa, Tanzania, inferred from diatom analysis},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{vincens2005a23000yrpollenrecordfromlakerukwa8sswtanzanianewdataonvegetationdynamicsandclimateincentraleasternafrica,
  doi = {10.1016/j.revpalbo.2005.06.001},
  url = {http://dx.doi.org/10.1016/j.revpalbo.2005.06.001},
  year = {2005},
  month = {dec},
  publisher = {Elsevier BV},
  volume = {137},
  number = {3–4},
  pages = {147–162},
  author = {Annie Vincens and Guillaume Buchet and David Williamson and Maurice Taieb},
  title = {A 23,000 yr pollen record from Lake Rukwa (8°S, SW Tanzania): New data on vegetation dynamics and climate in Central Eastern Africa},
  journal = {Review of Palaeobotany and Palynology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{lamb2007latepleistocenedesiccationoflaketanasourceofthebluenile,
  doi = {10.1016/j.quascirev.2006.11.020},
  url = {http://dx.doi.org/10.1016/j.quascirev.2006.11.020},
  year = {2007},
  month = {feb},
  publisher = {Elsevier BV},
  volume = {26},
  number = {3–4},
  pages = {287–299},
  author = {Henry F. Lamb and C. Richard Bates and Paul V. Coombes and Michael H. Marshall and Mohammed Umer and Sarah J. Davies and Eshete Dejen},
  title = {Late Pleistocene desiccation of Lake Tana, source of the Blue Nile},
  journal = {Quaternary Science Reviews},
}

@Article{marshall2011latepleistoceneandholocenedroughteventsatlaketanathesourceofthebluenile,
  doi = {10.1016/j.gloplacha.2011.06.004},
  url = {https://doi.org/10.1016/j.gloplacha.2011.06.004},
  year = {2011},
  month = {aug},
  publisher = {Elsevier {BV}},
  volume = {78},
  number = {3-4},
  pages = {147--161},
  author = {Michael H. Marshall and Henry F. Lamb and Dei Huws and Sarah J. Davies and Richard Bates and Jan Bloemendal and John Boyle and Melanie J. Leng and Mohammed Umer and Charlotte Bryant},
  title = {Late Pleistocene and Holocene drought events at Lake Tana, the source of the Blue Nile},
  journal = {Global and Planetary Change},
}

@Article{costa2014isotopicreconstructionoftheafricanhumidperiodandcongoairboundarymigrationatlaketanaethiopia,
  doi = {10.1016/j.quascirev.2013.10.031},
  url = {https://doi.org/10.1016/j.quascirev.2013.10.031},
  year = {2014},
  month = {jan},
  publisher = {Elsevier {BV}},
  volume = {83},
  pages = {58--67},
  author = {Kassandra Costa and James Russell and Bronwen Konecky and Henry Lamb},
  title = {Isotopic reconstruction of the African Humid Period and Congo Air Boundary migration at Lake Tana, Ethiopia},
  journal = {Quaternary Science Reviews},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Misc{stoffers1978latepleistoceneholoceneevolutionofthekivutanganyikabasin,
  doi = {10.1002/9781444303698.ch3},
  url = {http://dx.doi.org/10.1002/9781444303698.ch3},
  year = {1978},
  month = {nov},
  publisher = {Wiley},
  pages = {43–55},
  author = {Peter Stoffers and R. E. Hecky},
  title = {Late Pleistocene–;Holocene Evolution of the Kivu–Tanganyika Basin},
  journal = {Modern and Ancient Lake Sediments},
}

@Article{re1987thelatepleistoceneandholocenestratigraphyandpaleolimnologyoflakeskivaandtanganyika,
  year = {1987},
  author = {K.A {list Hecky R.E.}},
  title = {The late pleistocene and holocene stratigraphy and paleolimnology of Lakes Kiva and Tanganyika},
  journal = {unknown},
}

@Article{gasse1989waterlevelfluctuationsoflaketanganyikainphasewithoceanicchangesduringthelastglaciationanddeglaciation,
  doi = {10.1038/342057a0},
  url = {http://dx.doi.org/10.1038/342057a0},
  year = {1989},
  month = {nov},
  publisher = {Springer Science and Business Media LLC},
  volume = {342},
  number = {6245},
  pages = {57–59},
  author = {Franpoise Gasse and Vincent L{\a'e}d{\a'e}e and Marc Massault and Jean-Charles Fontes},
  title = {Water-level fluctuations of Lake Tanganyika in phase with oceanic changes during the last glaciation and deglaciation},
  journal = {Nature},
}

@Article{casanova1992lateholocenehydrologicalhistoryoflaketanganyikaeastafricafromisotopicdataonfossilstromatolites,
  doi = {10.1016/0031-0182(92)90030-9},
  url = {http://dx.doi.org/10.1016/0031-0182(92)90030-9},
  year = {1992},
  month = {jan},
  publisher = {Elsevier BV},
  volume = {91},
  number = {1–2},
  pages = {35–48},
  author = {J. Casanova and C. Hillaire-Marcel},
  title = {Late holocene hydrological history of Lake Tanganyika, East Africa, from isotopic data on fossil stromatolites},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{p1997lakelevelandpaleoenvironmentalhistoryoflaketanganyikaafricaasinferredfromlateholoceneandmodernstromatolites,
  doi = {6(1997)109<0444:LLAPHO>2.3.CO;2},
  year = {1997},
  author = {A.S {list Abell P.}},
  title = {Lake level and paleoenvironmental history of Lake Tanganyika, Africa, as inferred from late Holocene and modern stromatolites},
  journal = {unknown},
}

@Article{listnicholson1999historicalandmodernfluctuationsoflakestanganyikaandrukwaandtheirrelationshiptorainfallvariability,
  doi = {10.1023/A:1005424619718},
  year = {1999},
  publisher = {Springer Science and Business Media LLC},
  volume = {41},
  pages = {53–71},
  author = {Sharon E.") list("Nicholson},
  title = {Historical and Modern Fluctuations of Lakes Tanganyika and Rukwa and Their Relationship to Rainfall Variability},
  journal = {Climatic Change},
}

@Article{alin2003lakelevelhistoryoflaketanganyikaeastafricaforthepast2500yearsbasedonostracodeinferredwaterdepthreconstruction,
  doi = {10.1016/s0031-0182(03)00484-x},
  url = {http://dx.doi.org/10.1016/S0031-0182(03)00484-X},
  year = {2003},
  month = {oct},
  publisher = {Elsevier BV},
  volume = {199},
  number = {1–2},
  pages = {31–49},
  author = {Simone R Alin and Andrew S Cohen},
  title = {Lake-level history of Lake Tanganyika, East Africa, for the past 2500 years based on ostracode-inferred water-depth reconstruction},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{colman2003paleolimnologyoflaketanganyikaeastafricaoverthepast100kyr,
  doi = {10.1023/A:1025522116249},
  year = {2003},
  publisher = {Springer Science and Business Media LLC},
  volume = {30},
  pages = {139–150},
  author = {Christopher A. {list Colman}},
  title = {Paleolimnology of Lake Tanganyika, East Africa, over the past 100 kyr},
  journal = {Journal of Paleolimnology},
}

@Article{cohen2005paleolimnologicalinvestigationsofanthropogenicenvironmerestationatlaketanganyikaandimpactsonthelaketanganyikaecosystem,
  doi = {10.1007/s10933-005-2422-4},
  url = {http://dx.doi.org/10.1007/s10933-005-2422-4},
  year = {2005},
  month = {jul},
  publisher = {Springer Science and Business Media LLC},
  volume = {34},
  number = {1},
  pages = {125–145},
  author = {Andrew S. Cohen and Manuel R. Palacios-Fest and Emma S. Msaky and Simone R. Alin and Brent McKee and Catherine M. O\textquoterightReilly and David L. Dettman and Hudson Nkotagu and Kiram E. Lezzar},
  title = {Paleolimnological investigations of anthropogenic environmental change in Lake Tanganyika: IX. Summary of paleorecords of environmental change and catchment deforestation at Lake Tanganyika and impacts on the Lake Tanganyika ecosystem},
  journal = {Journal of Paleolimnology},
}

@Article{felton2007paleolimnologicalevidencefortheonsetandterminationofglacialaridityfromlaketanganyikatropicaleastafrica,
  doi = {10.1016/j.palaeo.2007.04.003},
  url = {http://dx.doi.org/10.1016/j.palaeo.2007.04.003},
  year = {2007},
  month = {sep},
  publisher = {Elsevier BV},
  volume = {252},
  number = {3–4},
  pages = {405–423},
  author = {Anna A. Felton and James M. Russell and Andrew S. Cohen and Mark E. Baker and John T. Chesley and Kiram E. Lezzar and Michael M. McGlue and Jeffrey S. Pigati and Jay Quade and J. {Curt Stager} and Jean Jacques Tiercelin},
  title = {Paleolimnological evidence for the onset and termination of glacial aridity from Lake Tanganyika, Tropical East Africa},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{stager2009alateholocenepaleoclimatichistoryoflaketanganyikaeastafrica,
  doi = {10.1016/j.yqres.2009.04.003},
  url = {http://dx.doi.org/10.1016/j.yqres.2009.04.003},
  year = {2009},
  month = {jul},
  publisher = {Cambridge University Press (CUP)},
  volume = {72},
  number = {1},
  pages = {47–56},
  author = {J. Curt Stager and Christine Cocquyt and Raymonde Bonnefille and Constanze Weyhenmeyer and Nicole Bowerman},
  title = {A late Holocene paleoclimatic history of Lake Tanganyika, East Africa},
  journal = {Quaternary Research},
}

@Article{tierney2010amolecularperspectiveonlatequaternaryclimateandvegetationchangeinthelaketanganyikabasineastafrica,
  doi = {10.1016/j.quascirev.2009.11.030},
  url = {http://dx.doi.org/10.1016/j.quascirev.2009.11.030},
  year = {2010},
  month = {mar},
  publisher = {Elsevier BV},
  volume = {29},
  number = {5–6},
  pages = {787–800},
  author = {Jessica E. Tierney and James M. Russell and Yongsong Huang},
  title = {A molecular perspective on Late Quaternary climate and vegetation change in the Lake Tanganyika basin, East Africa},
  journal = {Quaternary Science Reviews},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{kw1971recenthistoryofanethiopiandeltatheomoriverandtheleveloflakerudolf,
  year = {1971},
  author = {) list("Butzer K.W.},
  title = {Recent history of an Ethiopian delta: the Omo River and the level of Lake Rudolf},
  journal = {unknown},
}

@Article{butzer1972radiocarbondatingofeastafricanlakelevelsnewobservationsprovidefreshinsightsintolatequaternarypaleoclimates,
  doi = {10.1126/science.175.4026.1069},
  url = {http://dx.doi.org/10.1126/science.175.4026.1069},
  year = {1972},
  month = {mar},
  publisher = {American Association for the Advancement of Science (AAAS)},
  volume = {175},
  number = {4026},
  pages = {1069–1076},
  author = {Karl W. Butzer and Glynn L. Isaac and Jonathan L. Richardson and Celia Washbourn-Kamau},
  title = {Radiocarbon Dating of East African Lake Levels: New observations provide fresh insights into late Quaternary paleoclimates.},
  journal = {Science},
}

@Article{lh1972archeologyintheturkanadistrictkenya,
  year = {1972},
  author = {) list("Robbins L.H.},
  title = {Archeology in the Turkana District, Kenya},
  journal = {unknown},
}

@Article{dw1977thelaterprehistoryofeasternandsouthernafrica,
  year = {1977},
  author = {) list("Phillipson D.W.},
  title = {The later prehistory of Eastern and Southern Africa},
  journal = {unknown},
}

@Article{owen1982palaeolimnologyandarchaeologyofholocenedepositsnortheastoflaketurkanakenya,
  doi = {10.1038/298523a0},
  url = {http://dx.doi.org/10.1038/298523a0},
  year = {1982},
  month = {aug},
  publisher = {Springer Science and Business Media LLC},
  volume = {298},
  number = {5874},
  pages = {523–529},
  author = {R. B. Owen and J. W. Barthelme and R. W. Renaut and A. Vincens},
  title = {Palaeolimnology and archaeology of Holocene deposits north-east of Lake Turkana, Kenya},
  journal = {Nature},
}

@Article{halfman1988highresolutionrecordofcyclicclimaticchangeduringthepast4kafromlaketurkanakenya,
  doi = {10.1130/0091-7613(1988)016<0496:hrrocc>2.3.co;2},
  url = {http://dx.doi.org/10.1130/0091-7613(1988)016<0496:HRROCC>2.3.CO;2},
  year = {1988},
  publisher = {Geological Society of America},
  volume = {16},
  number = {6},
  pages = {496},
  author = {John D. Halfman and Thomas C. Johnson},
  title = {High-resolution record of cyclic climatic change during the past 4 ka from Lake Turkana, Kenya},
  journal = {Geology},
}

@Article{johnson1991paleoclimateofthepast4000yearsatlaketurkanakenyabasedontheisotopiccompositionofauthigeniccalcite,
  doi = {10.1016/0031-0182(91)90158-n},
  url = {http://dx.doi.org/10.1016/0031-0182(91)90158-N},
  year = {1991},
  month = {jun},
  publisher = {Elsevier BV},
  volume = {85},
  number = {3–4},
  pages = {189–198},
  author = {T.C. Johnson and J.D. Halfman and W.J. Showers},
  title = {Paleoclimate of the past 4000 years at Lake Turkana, Kenya, based on the isotopic composition of authigenic calcite},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{halfman1992fossildiatomsandthemidtolateholocenepaleolimnologyoflaketurkanakenyaareconnaissancestudy,
  doi = {10.1007/bf00197029},
  url = {http://dx.doi.org/10.1007/BF00197029},
  year = {1992},
  publisher = {Springer Science and Business Media LLC},
  volume = {7},
  number = {1},
  author = {JohnD. Halfman and DavidF. Jacobson and CarolynM. Cannella and KurtA. Haberyan and BruceP. Finney},
  title = {Fossil diatoms and the mid to late holocene paleolimnology of Lake Turkana, Kenya: a reconnaissance study},
  journal = {Journal of Paleolimnology},
}

@Article{halfman1994newamsdatesstratigraphiccorrelationsanddecadalclimaticcyclesforthepast4kaatlaketurkanakenya,
  doi = {10.1016/0031-0182(94)90349-2},
  url = {http://dx.doi.org/10.1016/0031-0182(94)90349-2},
  year = {1994},
  month = {sep},
  publisher = {Elsevier BV},
  volume = {111},
  number = {1–2},
  pages = {83–98},
  author = {John D. Halfman and Thomas C. Johnson and Bruce P. Finney},
  title = {New AMS dates, stratigraphic correlations and decadal climatic cycles for the past 4 ka at Lake Turkana, Kenya},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{ricketts1996climatechangeintheturkanabasinasdeducedfroma4000yearlongo18record,
  doi = {10.1016/0012-821x(96)00094-5},
  url = {http://dx.doi.org/10.1016/0012-821X(96)00094-5},
  year = {1996},
  month = {jul},
  publisher = {Elsevier BV},
  volume = {142},
  number = {1–2},
  pages = {7–17},
  author = {R.D. Ricketts and T.C. Johnson},
  title = {Climate change in the Turkana basin as deduced from a 4000 year long δO18 record},
  journal = {Earth and Planetary Science Letters},
}

@Article{mohammed1996pollenandisotopicrecordsinlateholocenesedimentsfromlaketurkanakenya,
  doi = {10.1016/0031-0182(95)00020-8},
  url = {http://dx.doi.org/10.1016/0031-0182(95)00020-8},
  year = {1996},
  month = {jan},
  publisher = {Elsevier BV},
  volume = {119},
  number = {3–4},
  pages = {371–383},
  author = {M.U. Mohammed and R. Bonnefille and T.C. Johnson},
  title = {Pollen and isotopic records in Late Holocene sediments from Lake Turkana, Kenya},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{se1998historicalfluctuationsoflakevictoriaandotherlakesinthenorthernriftvalleyofeastafrica,
  year = {1998},
  author = {) list("Nicholson S.E.},
  title = {Historical fluctuations of Lake Victoria and other lakes in the northern Rift Valley of East Africa},
  journal = {unknown},
}

@Article{brown2008stratigraphyandtephraofthekibishformationsouthwesternethiopia,
  doi = {10.1016/j.jhevol.2008.05.009},
  url = {http://dx.doi.org/10.1016/j.jhevol.2008.05.009},
  year = {2008},
  month = {sep},
  publisher = {Elsevier BV},
  volume = {55},
  number = {3},
  pages = {366–403},
  author = {Francis H. Brown and Chad R. Fuller},
  title = {Stratigraphy and tephra of the Kibish Formation, southwestern Ethiopia},
  journal = {Journal of Human Evolution},
}

@Article{s2010hydrologicalimpactsofethiopiasomobasinonkenyaslaketurkanawaterlevelsandfisheries,
  year = {2010},
  author = {) list("Avery S.},
  title = {Hydrological impacts of Ethiopia s Omo Basin on Kenya s Lake Turkana water levels and fisheries},
  journal = {unknown},
}

@Article{velpuri2012amultisourcesatellitedataapproachformodellinglaketurknawaterlevelcalibrationandvalidationusingsatellitealtimetrydata,
  doi = {10.5194/hess-16-1-2012},
  url = {http://dx.doi.org/10.5194/hess-16-1-2012},
  year = {2012},
  month = {jan},
  publisher = {Copernicus GmbH},
  volume = {16},
  number = {1},
  pages = {1–18},
  author = {N. M. Velpuri and G. B. Senay and K. O. Asante},
  title = {A multi-source satellite data approach for modelling Lake Turkana water level: calibration and validation using satellite altimetry data},
  journal = {Hydrology and Earth System Sciences},
}

@Article{garcin2012eastafricanmidholocenewetdrytransitionrecordedinpalaeoshorelinesoflaketurkananorthernkenyarift,
  doi = {10.1016/j.epsl.2012.03.016},
  url = {http://dx.doi.org/10.1016/j.epsl.2012.03.016},
  year = {2012},
  month = {may},
  publisher = {Elsevier BV},
  volume = {331–332},
  pages = {322–334},
  author = {Yannick Garcin and Daniel Melnick and Manfred R. Strecker and Daniel Olago and Jean-Jacques Tiercelin},
  title = {East African mid-Holocene wet–dry transition recorded in palaeo-shorelines of Lake Turkana, northern Kenya Rift},
  journal = {Earth and Planetary Science Letters},
}

@Article{morrissey2014paleohydrologyoflaketurkanaanditsinfluenceonthenileriversystem,
  doi = {10.1016/j.palaeo.2014.03.029},
  url = {http://dx.doi.org/10.1016/j.palaeo.2014.03.029},
  year = {2014},
  month = {jun},
  publisher = {Elsevier BV},
  volume = {403},
  pages = {88–100},
  author = {Amy Morrissey and Christopher A. Scholz},
  title = {Paleohydrology of Lake Turkana and its influence on the Nile River system},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{forman2014variationsinwaterlevelforlaketurkanainthepast8500yearskenyaandthetransitionfromtheafricanhumidperiodtoholocenearidity,
  doi = {10.1016/j.quascirev.2014.05.005},
  url = {http://dx.doi.org/10.1016/j.quascirev.2014.05.005},
  year = {2014},
  month = {aug},
  publisher = {Elsevier BV},
  volume = {97},
  pages = {84–101},
  author = {Steven L. Forman and David K. Wright and Christopher Bloszies},
  title = {Variations in water level for Lake Turkana in the past 8500 years near Mt. Porr, Kenya and the transition from the African Humid Period to Holocene aridity},
  journal = {Quaternary Science Reviews},
}

@Article{bloszies2015potentialrelationbetweenequatorialseasurfacetemperaturesandhistoricwaterlevelvariabilityforlaketurkanakenya,
  doi = {10.1016/j.jhydrol.2014.10.001},
  url = {http://dx.doi.org/10.1016/j.jhydrol.2014.10.001},
  year = {2015},
  month = {jan},
  publisher = {Elsevier BV},
  volume = {520},
  pages = {489–501},
  author = {Chris Bloszies and Steven L. Forman},
  title = {Potential relation between equatorial sea surface temperatures and historic water level variability for Lake Turkana, Kenya},
  journal = {Journal of Hydrology},
}

@Article{bloszies2015waterlevelhistoryforlaketurkanakenyainthepast15000yendavariabletransitionfromtheafricanhumidperiodtoholocenearidity,
  doi = {10.1016/j.gloplacha.2015.06.006},
  url = {http://dx.doi.org/10.1016/j.gloplacha.2015.06.006},
  year = {2015},
  month = {sep},
  publisher = {Elsevier BV},
  volume = {132},
  pages = {64–76},
  author = {C. Bloszies and S.L. Forman and D.K. Wright},
  title = {Water level history for Lake Turkana, Kenya in the past 15,000years and a variable transition from the African Humid Period to Holocene aridity},
  journal = {Global and Planetary Change},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{stuiver1960yalenaturalradiocarbonmeasurementsv,
  doi = {10.1017/s1061592x00020597},
  url = {http://dx.doi.org/10.1017/S1061592X00020597},
  year = {1960},
  publisher = {Cambridge University Press (CUP)},
  volume = {2},
  pages = {49–61},
  author = {Minze Stuiver and Edward S. Deevey and L. J. Gralenski},
  title = {Yale Natural Radiocarbon Measurements V},
  journal = {American Journal of Science. Radiocarbon Supplement},
}

@Article{rl1969anecologicalhistoryofthelakevictoriabasin,
  doi = {http://www.jstor.org/stable/1950740},
  year = {1969},
  author = {) list("Kendall R.L.},
  title = {An Ecological History of the Lake Victoria Basin},
  journal = {unknown},
}

@Article{liststager1984thediatomrecordoflakevictoriaeastafricathelast17000years,
  year = {1984},
  author = {J.C.") list("Stager},
  title = {The diatom record of Lake Victoria (East Africa): The last 17,000 years},
  journal = {unknown},
}

@Article{stager1986a25000yearhistoryforlakevictoriaeastafricaandsomecommentsonitssignificancefortheevolutionofcichlidfishes,
  doi = {10.1111/j.1365-2427.1986.tb00944.x},
  url = {http://dx.doi.org/10.1111/j.1365-2427.1986.tb00944.x},
  year = {1986},
  month = {feb},
  publisher = {Wiley},
  volume = {16},
  number = {1},
  pages = {15–19},
  author = {J. C. STAGER and P. N. REINTHAL and D. A. LIVINGSTONE},
  title = {A 25,000‐year history for Lake Victoria, East Africa, and some comments on its significance for the evolution of cichlid fishes},
  journal = {Freshwater Biology},
}

@Article{plinston1994areviewandupdateofthehydrologyoflakevictoriaineastafrica,
  year = {1994},
  author = {K.J {list Plinston}},
  title = {A review and update of the hydrology of Lake Victoria in East Africa},
  journal = {unknown},
}

@Article{seehausen1997cichlidfishdiversitythreatenedbyeutrophicationthatcurbssexualselection,
  doi = {10.1126/science.277.5333.1808},
  url = {http://dx.doi.org/10.1126/science.277.5333.1808},
  year = {1997},
  month = {sep},
  publisher = {American Association for the Advancement of Science (AAAS)},
  volume = {277},
  number = {5333},
  pages = {1808–1811},
  author = {Ole Seehausen and Jacques J. M. {van Alphen} and Frans Witte},
  title = {Cichlid Fish Diversity Threatened by Eutrophication That Curbs Sexual Selection},
  journal = {Science},
}

@Article{stager1997ahighresolution11400yrdiatomrecordfromlakevictoriaeastafrica,
  doi = {10.1006/qres.1996.1863},
  url = {http://dx.doi.org/10.1006/qres.1996.1863},
  year = {1997},
  month = {jan},
  publisher = {Cambridge University Press (CUP)},
  volume = {47},
  number = {1},
  pages = {81–89},
  author = {J.Curt Stager and Brian Cumming and Loren Meeker},
  title = {A High-Resolution 11,400-Yr Diatom Record from Lake Victoria, East Africa},
  journal = {Quaternary Research},
}

@Article{verschuren1998biogenicsilicaprofilesinholocenecoresfromlakevictoiaimplicationsforlakelevelhistoryandinitiationofthevictorianile,
  year = {1998},
  author = {T.C {list Verschuren}},
  title = {Biogenic silica profiles in Holocene cores from Lake Victoria: implications for lake level history and initiation of the Victoria Nile},
  journal = {unknown},
}

@Article{e2000theholocenehistoryoflakevictoria29211,
  doi = {http://www.jstor.org/stable/4314987},
  year = {2000},
  author = {T.C {list Odada E.}},
  title = {The Holocene History of Lake Victoria 29, 2–11},
  journal = {unknown},
}

@Article{stager2002coolingcyclesheinrichevent1andthedesiccationoflakevictoria,
  doi = {10.1016/s0031-0182(01)00468-0},
  url = {http://dx.doi.org/10.1016/S0031-0182(01)00468-0},
  year = {2002},
  month = {jul},
  publisher = {Elsevier BV},
  volume = {183},
  number = {1–2},
  pages = {169–178},
  author = {J.Curt Stager and Paul A Mayewski and L.David Meeker},
  title = {Cooling cycles, Heinrich event 1, and the desiccation of Lake Victoria},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{beuning2002reassessmentoflakevictoriauppernileriverpaleohydrologyfromoxygenisotoperecordsoflakesedimentcellulose,
  doi = {10.1130/0091-7613(2002)030<0559:rolvun>2.0.co;2},
  url = {http://dx.doi.org/10.1130/0091-7613(2002)030<0559:ROLVUN>2.0.CO;2},
  year = {2002},
  publisher = {Geological Society of America},
  volume = {30},
  number = {6},
  pages = {559},
  author = {Kristina R.M. Beuning and Kerry Kelts and Jim Russell and Brent B. Wolfe},
  title = {Reassessment of Lake Victoria–Upper Nile River paleohydrology from oxygen isotope records of lake-sediment cellulose},
  journal = {Geology},
}

@Article{stager2003a10000yearhighresolutiondiatomrecordfrompilkingtonbaylakevictoriaeastafrica,
  doi = {10.1016/s0033-5894(03)00008-5},
  url = {https://doi.org/10.1016/s0033-5894(03)00008-5},
  year = {2003},
  month = {mar},
  publisher = {Cambridge University Press ({CUP})},
  volume = {59},
  number = {2},
  pages = {172--181},
  author = {J. Curt Stager and Brian F. Cumming and L. David Meeker},
  title = {A 10,000-year high-resolution diatom record from Pilkington Bay, Lake Victoria, East Africa},
  journal = {Quaternary Research},
}

@Article{stager2005a5500yearenvironmentalhistoryoflakenabugabouganda,
  doi = {10.1016/j.palaeo.2004.12.025},
  url = {http://dx.doi.org/10.1016/j.palaeo.2004.12.025},
  year = {2005},
  month = {mar},
  publisher = {Elsevier BV},
  volume = {218},
  number = {3–4},
  pages = {347–354},
  author = {J. Curt Stager and J. Westwood and D. Grzesik and B.F. Cumming},
  title = {A 5500-year environmental history of Lake Nabugabo, Uganda},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{stager2005solarvariabilityandthelevelsoflakevictoriaeastafricaduringthelastmillenium,
  doi = {10.1007/s10933-004-4227-2},
  url = {http://dx.doi.org/10.1007/s10933-004-4227-2},
  year = {2005},
  month = {feb},
  publisher = {Springer Science and Business Media LLC},
  volume = {33},
  number = {2},
  pages = {243–251},
  author = {J. Curt Stager and David Ryves and Brian F. Cumming and L. David Meeker and Juerg Beer},
  title = {Solar variability and the levels of Lake Victoria, East Africa, during the last millenium},
  journal = {Journal of Paleolimnology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{kokarovtsev1991missingtitle,
  year = {1991},
  author = {{Kokarovtsev}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{nikolskaya1986missingtitle,
  year = {1986},
  author = {{Nikol'skaya}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{zubovich1988missingtitle,
  year = {1988},
  author = {{Zubovich}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{woodward2014aholocenerecordofclimateandhydrologicalchangesfromlittlellangothlinlagoonsoutheasternaustralia,
  year = {2014},
  author = {C Woodward},
  title = {A Holocene record of climate and hydrological changes from Little Llangothlin Lagoon, south eastern Australia},
  journal = {The Holocene},
}

@Article{ellerton2017lastglacialmaximumandlastglacialinterglacialtransititelastglacialmaximumanddrydeglaciationinpartsofeasternaustralia,
  year = {2017},
  author = {D Ellerton},
  title = {Last Glacial Maximum and Last Glacial-Interglacial Transition pollen record from northern NSW, Australia: evidence for a humid late Last Glacial Maximum and dry deglaciation in parts of eastern Australia},
  journal = {Journal of Quaternary Science},
}

@Article{shulmeister2016constantwindregimesduringthelastglacialmaximumandfromlittlellangothlinlagoonnewenglandtablelandseasternaustralia,
  year = {2016},
  author = {J Shulmeister},
  title = {Constant wind regimes during the Last Glacial Maximum and early Holocene: evidence from Little Llangothlin Lagoon, New England Tablelands, eastern Australia},
  journal = {Climate of the Past},
}

@Article{clerke2023hydrologicalregimeofaustralianlakesoverthelatequaternaryandholocene,
  doi = {10.25949/22662253.v1},
  year = {2023},
  author = {L. Clerke},
  title = {Hydrological regime of Australian lakes over the Late-Quaternary and Holocene},
  journal = {PhD Thesis},
}

@Article{wu1994missingtitle,
  year = {1994},
  author = {{Wu}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yan1983missingtitle,
  year = {1983},
  author = {{Yan}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{levkovskaya1987missingtitle,
  year = {1987},
  author = {{Levkovskaya}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{loze1988missingtitle,
  year = {1988},
  author = {{Loze}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{loze1983missingtitle,
  year = {1983},
  author = {{Loze}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{shaw1986geomorphicevidenceforthelatequaternarypalaeoclimatesofthemiddlekalahariofnorthernbotswana,
  doi = {10.1016/0341-8162(86)90009-3},
  url = {http://dx.doi.org/10.1016/0341-8162(86)90009-3},
  year = {1986},
  month = {dec},
  publisher = {Elsevier BV},
  volume = {13},
  number = {4},
  pages = {349–359},
  author = {P.A. Shaw and H.J. Cooke},
  title = {Geomorphic evidence for the late Quaternary palaeoclimates of the middle Kalahari of northern Botswana},
  journal = {CATENA},
}

@Article{dsg1988lakecaprivialatequaternarylinkbetweenthezambeziandmiddlekalaharidrainagesystems,
  year = {1988},
  author = {P {list Thomas D.S.G.}},
  title = {Lake Caprivi: a late Quaternary link between the Zambezi and middle Kalahari drainage systems},
  journal = {unknown},
}

@Article{dsg1993geomorphologicalprocessesenvironmentalchangeandlandscapesensitivityinthekalahariregionofsouthernafrica,
  year = {1993},
  author = {P {list Thomas D.S.G.}},
  title = {Geomorphological Processes, Environmental Change and Landscape Sensitivity in the Kalahari Region of Southern Africa},
  journal = {unknown},
}

@Article{burrough2008latequaternarylakelevelfluctuationsinthemababedepressionmiddlekalaharipalaeolakesandtheroleofzambeziinflows,
  doi = {10.1016/j.yqres.2008.02.003},
  url = {http://dx.doi.org/10.1016/j.yqres.2008.02.003},
  year = {2008},
  month = {may},
  publisher = {Cambridge University Press (CUP)},
  volume = {69},
  number = {03},
  pages = {388–403},
  author = {S.L. Burrough and D.S.G. Thomas},
  title = {Late Quaternary lake-level fluctuations in the Mababe Depression: Middle Kalahari palaeolakes and the role of Zambezi inflows},
  journal = {Quaternary Research},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{beug1962missingtitle,
  year = {1962},
  author = {{Beug}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{beug1967missingtitle,
  year = {1967},
  author = {{Beug}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{beug1975missingtitle,
  year = {1975},
  author = {{Beug}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{rhodes1996missingtitle,
  year = {1996},
  author = {{Rhodes}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{sun1994missingtitle,
  year = {1994},
  author = {{Sun}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{wei1999missingtitle,
  year = {1999},
  author = {{Wei}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{khotinskii1991missingtitle,
  year = {1991},
  author = {{Khotinskii}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{butzer1972radiocarbondatingofeastafricanlakelevelsnewobservationsprovidefreshinsightsintolatequaternarypaleoclimates,
  doi = {10.1126/science.175.4026.1069},
  url = {http://dx.doi.org/10.1126/science.175.4026.1069},
  year = {1972},
  month = {mar},
  publisher = {American Association for the Advancement of Science (AAAS)},
  volume = {175},
  number = {4026},
  pages = {1069–1076},
  author = {Karl W. Butzer and Glynn L. Isaac and Jonathan L. Richardson and Celia Washbourn-Kamau},
  title = {Radiocarbon Dating of East African Lake Levels: New observations provide fresh insights into late Quaternary paleoclimates.},
  journal = {Science},
}

@Article{vareschi1982theecologyoflakenakurukenyaiiiabioticfactorsandprimaryproduction,
  doi = {10.1007/bf00386722},
  url = {http://dx.doi.org/10.1007/BF00386722},
  year = {1982},
  month = {oct},
  publisher = {Springer Science and Business Media LLC},
  volume = {55},
  number = {1},
  pages = {81–101},
  author = {E. Vareschi},
  title = {The ecology of Lake Nakuru (Kenya): III. Abiotic factors and primary production},
  journal = {Oecologia},
}

@Article{cohen1983lacustrinepaleochemicalinterpretationsbasedoneasternandsouthernafricanostracodes,
  doi = {10.1016/0031-0182(83)90051-2},
  url = {http://dx.doi.org/10.1016/0031-0182(83)90051-2},
  year = {1983},
  month = {aug},
  publisher = {Elsevier BV},
  volume = {43},
  number = {1–2},
  pages = {129–151},
  author = {Andrew S. Cohen and Richard Dussinger and Johnathan Richardson},
  title = {Lacustrine paleochemical interpretations based on Eastern and Southern african ostracodes},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{richardson1986paleolimnologyofmidelevationlakesinthekenyariftvalley,
  doi = {10.1007/bf00026659},
  url = {http://dx.doi.org/10.1007/BF00026659},
  year = {1986},
  month = {dec},
  publisher = {Springer Science and Business Media LLC},
  volume = {143},
  number = {1},
  pages = {167–174},
  author = {J. L. Richardson and R. A. Dussinger},
  title = {Paleolimnology of mid-elevation lakes in the Kenya Rift Valley},
  journal = {Hydrobiologia},
}

@Article{dhnforth2006earlyholocenewaterbudgetofthenakuruelmenteitabasincentralkenyarift,
  doi = {10.1007/s10933-006-9003-z},
  url = {http://dx.doi.org/10.1007/s10933-006-9003-z},
  year = {2006},
  month = {aug},
  publisher = {Springer Science and Business Media LLC},
  volume = {36},
  number = {3},
  pages = {281–294},
  author = {Miriam D{\"u}hnforth and Andreas G. N. Bergner and Martin H. Trauth},
  title = {Early Holocene water budget of the Nakuru-Elmenteita basin, Central Kenya Rift},
  journal = {Journal of Paleolimnology},
}

@Article{decort2013lateholoceneandrecenthydroclimaticvariabilityinthecentythesedimentrecordofhypersalinelakesbogorianakuruandelementeita,
  doi = {10.1016/j.palaeo.2013.07.029},
  url = {http://dx.doi.org/10.1016/j.palaeo.2013.07.029},
  year = {2013},
  month = {oct},
  publisher = {Elsevier BV},
  volume = {388},
  pages = {69–80},
  author = {Gijs {De Cort} and Ilse Bessems and Edward Keppens and Florias Mees and Brian Cumming and Dirk Verschuren},
  title = {Late-Holocene and recent hydroclimatic variability in the central Kenya Rift Valley: The sediment record of hypersaline lakes Bogoria, Nakuru and Elementeita},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{yakushko1987missingtitle,
  year = {1987},
  author = {{Yakushko}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{shaw2003holocenefluctuationsoflakengamimiddlekalaharichronologyandresponsestoclimaticchange,
  doi = {10.1016/s1040-6182(03)00012-0},
  url = {http://dx.doi.org/10.1016/S1040-6182(03)00012-0},
  year = {2003},
  month = {jan},
  publisher = {Elsevier BV},
  volume = {111},
  number = {1},
  pages = {23–35},
  author = {Paul A. Shaw and Mark D. Bateman and David S.G. Thomas and Frances Davies},
  title = {Holocene fluctuations of Lake Ngami, Middle Kalahari: chronology and responses to climatic change},
  journal = {Quaternary International},
}

@Article{huntsmanmapila2006useofthegeochemicalandbiologicalsedimentaryrecpalaeoenvironmentsandclimatechangeinthelakengamibasinnwbotswana,
  doi = {10.1016/j.quaint.2005.11.029},
  url = {http://dx.doi.org/10.1016/j.quaint.2005.11.029},
  year = {2006},
  month = {may},
  publisher = {Elsevier BV},
  volume = {148},
  number = {1},
  pages = {51–64},
  author = {P. Huntsman-Mapila and S. Ringrose and A.W. Mackay and W.S. Downey and M. Modisi and S.H. Coetzee and J.-J. Tiercelin and A.B. Kampunzu and C. Vanderpost},
  title = {Use of the geochemical and biological sedimentary record in establishing palaeo-environments and climate change in the Lake Ngami basin, NW Botswana},
  journal = {Quaternary International},
}

@Article{burrough2007multiphasequaternaryhighstandsatlakengamikalaharinorthernbotswana,
  doi = {10.1016/j.palaeo.2007.06.010},
  url = {http://dx.doi.org/10.1016/j.palaeo.2007.06.010},
  year = {2007},
  month = {sep},
  publisher = {Elsevier BV},
  volume = {253},
  number = {3–4},
  pages = {280–299},
  author = {Sallie L. Burrough and David S.G. Thomas and Paul A. Shaw and Richard M. Bailey},
  title = {Multiphase Quaternary highstands at Lake Ngami, Kalahari, northern Botswana},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{menndez1963missingtitle,
  year = {1963},
  author = {{Men{{\a`E}}ndez}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{vogel1972missingtitle,
  year = {1972},
  author = {{Vogel}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{pons1986missingtitle,
  year = {1986},
  author = {{Pons}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{taakye1988missingtitle,
  year = {1988},
  author = {{Taakye}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{pirrus1969missingtitle,
  year = {1969},
  author = {{Pirrus}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{saarse1994missingtitle,
  year = {1994},
  author = {{Saarse}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{saarse1986missingtitle,
  year = {1986},
  author = {{Saarse}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{tarasov1992missingtitle,
  year = {1992},
  author = {{Tarasov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{leflat1993missingtitle,
  year = {1993},
  author = {{Leflat}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{oeggl1989missingtitle,
  year = {1989},
  author = {{Oeggl}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{sayadyan1977missingtitle,
  year = {1977},
  author = {{Sayadyan}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{kozyrenko1961missingtitle,
  year = {1961},
  author = {{Kozyrenko}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{zernitskaya1986missingtitle,
  year = {1986},
  author = {{Zernitskaya}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{zernitskaya1988missingtitle,
  year = {1988},
  author = {{Zernitskaya}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{elovicheva1993missingtitle,
  year = {1993},
  author = {{Elovicheva}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{elovicheva1985missingtitle,
  year = {1985},
  author = {{Elovicheva}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{vlasov1987missingtitle,
  year = {1987},
  author = {{Vlasov}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{truckle1976geologyandlatecainozoiclakesedimentsofthesugutatroughkenya,
  doi = {10.1038/263380a0},
  url = {http://dx.doi.org/10.1038/263380a0},
  year = {1976},
  month = {sep},
  publisher = {Springer Science and Business Media LLC},
  volume = {263},
  number = {5576},
  pages = {380–383},
  author = {P. H. Truckle},
  title = {Geology and late Cainozoic lake sediments of the Suguta Trough, Kenya},
  journal = {Nature},
}

@Article{garcin2009latepleistoceneholoceneriseandcollapseoflakesugutanorthernkenyarift,
  doi = {10.1016/j.quascirev.2008.12.006},
  url = {http://dx.doi.org/10.1016/j.quascirev.2008.12.006},
  year = {2009},
  month = {may},
  publisher = {Elsevier BV},
  volume = {28},
  number = {9–10},
  pages = {911–925},
  author = {Yannick Garcin and Annett Junginger and Daniel Melnick and Daniel O. Olago and Manfred R. Strecker and Martin H. Trauth},
  title = {Late Pleistocene–Holocene rise and collapse of Lake Suguta, northern Kenya Rift},
  journal = {Quaternary Science Reviews},
}

@Article{junginger2014theeffectsofsolarirradiationchangesonthemigrationofeolakesugutanorthernkenyariftduringtheafricanhumidperiod155kabp,
  doi = {10.1016/j.palaeo.2013.12.007},
  url = {http://dx.doi.org/10.1016/j.palaeo.2013.12.007},
  year = {2014},
  month = {feb},
  publisher = {Elsevier BV},
  volume = {396},
  pages = {1–16},
  author = {Annett Junginger and Sybille Roller and Lydia A. Olaka and Martin H. Trauth},
  title = {The effects of solar irradiation changes on the migration of the Congo Air Boundary and water levels of paleo-Lake Suguta, Northern Kenya Rift, during the African Humid Period (15–5ka BP)},
  journal = {Palaeogeography, Palaeoclimatology, Palaeoecology},
}

@Article{decort2021anuncertaintyfocuseddatabaseapproachtoextractspatiotemporaltrendsfromqualitativeanddiscontinuouslakestatushistories,
  doi = {10.1016/j.quascirev.2021.106870},
  url = {http://dx.doi.org/10.1016/j.quascirev.2021.106870},
  year = {2021},
  month = {apr},
  publisher = {Elsevier BV},
  volume = {258},
  pages = {106870},
  author = {Gijs {De Cort} and Manuel Chevalier and Sallie L. Burrough and Christine Y. Chen and Sandy P. Harrison},
  title = {An uncertainty-focused database approach to extract spatiotemporal trends from qualitative and discontinuous lake-status histories},
  journal = {Quaternary Science Reviews},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{khomutova1994missingtitle,
  year = {1994},
  author = {{Khomutova}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{khotinskii1977missingtitle,
  year = {1977},
  author = {{Khotinskii}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{kokarovtsev1992missingtitle,
  year = {1992},
  author = {{Kokarovtsev}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{placzek2006geochronologyandstratigraphyoflatepleistocenelakecyclrnbolivianaltiplanoimplicationsforcausesoftropicalclimatechange,
  doi = {10.1130/b25770.1},
  url = {http://dx.doi.org/10.1130/B25770.1},
  year = {2006},
  month = {may},
  publisher = {Geological Society of America},
  volume = {118},
  number = {5–6},
  pages = {515–532},
  author = {C. Placzek and J. Quade and P. J. Patchett},
  title = {Geochronology and stratigraphy of late Pleistocene lake cycles on the southern Bolivian Altiplano: Implications for causes of tropical climate change},
  journal = {Geological Society of America Bulletin},
}

@Article{khotinskii1977missingtitle,
  year = {1977},
  author = {{Khotinskii}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{tarasov1996lakestatusrecordsfromtheformersovietunionandmongoliadocumentationofthesecondversionofthedatabase,
  year = {1996},
  author = {P.E Tarasov and M.Y Pushenko and S.P Harrison and L Saarse and A.A Andreev and Z.V Aleshinskaya and N.N Davydova and N.I Dorofeyuk and Y.V Efremov and G.A Elina and Y.K Elovicheva and L.V Filimonova and V.S Gunova and V.I Khomutova and E.V Kvavadze and I.Y Neustrueva and V.V Pisareva and V.S Volkova and T.S Shelekhova and D.A Subetto and O.N. Uspenskaya and V.P. Zernitskaya},
  title = {Lake Status Records from the Former Soviet Union and Mongolia: Documentation of the Second Version of the Data Base.},
  journal = {NOAA Paleoclimatology Publications Series Report No. 5. NOAA},
}

@Article{hjelmroosericsson1981missingtitle,
  year = {1981},
  author = {{Hjelmroos-Ericsson}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{hjelmroos1982missingtitle,
  year = {1982},
  author = {{Hjelmroos}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu1995lakestatusrecordsfromeuropedatabasedocumentation,
  year = {1995},
  author = {G. Yu},
  title = {Lake status records from Europe: Data base documentation},
  journal = {Publications Series Report #3},
}

@Article{li1995missingtitle,
  year = {1995},
  author = {{Li}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{shan1996missingtitle,
  year = {1996},
  author = {{Shan}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{li1992missingtitle,
  year = {1992},
  author = {{Li}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{huang1996missingtitle,
  year = {1996},
  author = {{Huang}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{zheng1996missingtitle,
  year = {1996},
  author = {{Zheng}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{qi1995missingtitle,
  year = {1995},
  author = {{Qi}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{wu1996missingtitle,
  year = {1996},
  author = {{Wu}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}

@Article{zheng1989missingtitle,
  year = {1989},
  author = {{Zheng}},
  title = {Missing Title},
  journal = {unknown},
}

@Article{yu2001lakestatusrecordsfromchinadatabasedocumentation,
  year = {2001},
  author = {G. Yu},
  title = {Lake status records from China: data base documentation},
  journal = {MPI-BGC Tech Rep 4},
}